(data stored in ACNUC30630 zone)

EMBL: BX251410.MENB

BX251410.MENB        Location/Qualifiers
FT   CDS             128106..129023
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="TW120"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="Similar to Escherichia coli naphthoate synthase MenB
FT                   or b2262 SWALL:MENB_ECOLI (SWALL:P27290) (285 aa) fasta
FT                   scores: E(): 1.3e-46, 48.76% id in 283 aa, and to
FT                   Mycobacterium tuberculosis MenB or Rv0548c or mtcy25d10.27c
FT                   or mt0573 SWALL:O06414 (EMBL:Z95558) (314 aa) fasta scores:
FT                   E(): 4.5e-71, 63.39% id in 295 aa"
FT                   /protein_id="CAD66802.1"
FT                   /translation="MGESKGAPTFDTLQHVLLSELFDPDLWVAHEGFEACDVTYHTAPG
FT                   VARIAFNRPEIRNAFRPETVDQLYAALDHARVSDKIGAVLLTGNGPSPRDGIRAFCAGG
FT                   DQKTRRRDGYAYSDSHRSSRMHILEVQRLIRFMPKPVIALVNGWAAGGGHSLHVVCDLS
FT                   IASLEHAKFKQTDATVASFDSGFGSAYFARQVGQKFAREVCFLAAEYDAKTALEKGAVN
FT                   AVVAHEYLEQTGYEWARRILEQSPTSIRMFKYALNAVDDGLVGQQIFAGEATRLAYATD
FT                   ESKEGRDAFLEKRRPDWSSFPWSF"
     MGESKGAPTF DTLQHVLLSE LFDPDLWVAH EGFEACDVTY HTAPGVARIA FNRPEIRNAF        60
     RPETVDQLYA ALDHARVSDK IGAVLLTGNG PSPRDGIRAF CAGGDQKTRR RDGYAYSDSH       120
     RSSRMHILEV QRLIRFMPKP VIALVNGWAA GGGHSLHVVC DLSIASLEHA KFKQTDATVA       180
     SFDSGFGSAY FARQVGQKFA REVCFLAAEY DAKTALEKGA VNAVVAHEYL EQTGYEWARR       240
     ILEQSPTSIR MFKYALNAVD DGLVGQQIFA GEATRLAYAT DESKEGRDAF LEKRRPDWSS       300
     FPWSF                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page