(data stored in ACNUC30630 zone)

EMBL: BX251410.MENE

BX251410.MENE        Location/Qualifiers
FT   CDS             129025..130161
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="TW121"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="Similar to Escherichia coli O-succinylbenzoic
FT                   acid--CoA ligase MenE or b2260 SWALL:MENE_ECOLI
FT                   (SWALL:P37353) (451 aa) fasta scores: E(): 2.5e-10, 28.11%
FT                   id in 345 aa, and to Mycobacterium tuberculosis MenE or
FT                   Rv0542c or mtcy25d10.21c or mt0567 SWALL:O06408
FT                   (EMBL:Z95558) (362 aa) fasta scores: E(): 2.5e-29, 32.84%
FT                   id in 338 aa"
FT                   /protein_id="CAD66803.1"
FT                   /translation="MTKALMRGQITLDSVKRVLEDERFAICASEEPLSCGGKIMVDDAV
FT                   CLVINTSGSTASPKRVAFSSSSLMNSARACCSVLGYGQWVLCLPKQYTAGVRVLVRSIL
FT                   SGTKPIDISEDRFSPENFIHACRRLSCSNTFTALVPTQLSALVRVAEDDKNVAKVLSGF
FT                   TGVIVGGQHIARSLLERSRLLGINLFTSYGLTETFGGCVYNGLPLPGVQIQIIDGRAAI
FT                   ASPSLALGYLKENGQIDETGFFFDRGERWFHTNDLAVMNRGKLIIHGRIDRVINSGGMK
FT                   LDLNAIETALRSLDCVEDAVLLGVKSKKWGQHFCAFIDIGDVTKADRTDCLQKINTLLS
FT                   TFGRACRSGQIKLIHPIPRTFSGKPDRIALQRGLQNNI"
     MTKALMRGQI TLDSVKRVLE DERFAICASE EPLSCGGKIM VDDAVCLVIN TSGSTASPKR        60
     VAFSSSSLMN SARACCSVLG YGQWVLCLPK QYTAGVRVLV RSILSGTKPI DISEDRFSPE       120
     NFIHACRRLS CSNTFTALVP TQLSALVRVA EDDKNVAKVL SGFTGVIVGG QHIARSLLER       180
     SRLLGINLFT SYGLTETFGG CVYNGLPLPG VQIQIIDGRA AIASPSLALG YLKENGQIDE       240
     TGFFFDRGER WFHTNDLAVM NRGKLIIHGR IDRVINSGGM KLDLNAIETA LRSLDCVEDA       300
     VLLGVKSKKW GQHFCAFIDI GDVTKADRTD CLQKINTLLS TFGRACRSGQ IKLIHPIPRT       360
     FSGKPDRIAL QRGLQNNI                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page