(data stored in ACNUC30630 zone)

EMBL: BX251410.MURA

BX251410.MURA        Location/Qualifiers
FT   CDS             283980..285305
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="TW254"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="Similar to Bacillus subtilis UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase 1 MurAa or MurA SWALL:MUA1_BACSU
FT                   (SWALL:P70965) (436 aa) fasta scores: E(): 3.9e-41, 35.94%
FT                   id in 434 aa, and to Streptomyces coelicolor
FT                   UDP-N-acetylglucosamine transferase MurA or SCO2949 or
FT                   SCE59.08 SWALL:Q9L1U5 (EMBL:AL138851) (448 aa) fasta
FT                   scores: E(): 5e-102, 58.73% id in 441 aa"
FT                   /protein_id="CAD66930.1"
FT                   /translation="MKLDSTPDRFVITGGSPLRGEIAVKGAKNLVTKAMVASMLGNSQS
FT                   VLTNVPNISDVLIVRRLMEAYNVSVRATQNDTLVIDPILLGQCSRGDIDVYAGSSRVPI
FT                   LFCGPLLHKTGQAFITGLGGCRIGERPIDFHLQALRKFGASHEKLPGGILLSTKKRLKG
FT                   ASVHFPYPSVGATEQVLLTAVLADGVTELRGAAIEPEIMDLIAILQKMGAIITCARDRV
FT                   IFIEGVDSLSGYTHHAISDRNEAASWACAALATRGDIFVRNAEQAHLLAFLSVYRKVGG
FT                   VFEIKDDGIRFFHPGGNLNPVVVETDVHPGFSTDWQQPLVVALTQASGRSVVHETVYES
FT                   RFGFTEALNRMGADISVHENGFQGTLRRVPHRAIEQAAVINGPTPLTGQDIDVPDLRGG
FT                   FSHFIAAFAAEGKSIITNAGIISRGYENFVHKLERLKVDFEA"
     MKLDSTPDRF VITGGSPLRG EIAVKGAKNL VTKAMVASML GNSQSVLTNV PNISDVLIVR        60
     RLMEAYNVSV RATQNDTLVI DPILLGQCSR GDIDVYAGSS RVPILFCGPL LHKTGQAFIT       120
     GLGGCRIGER PIDFHLQALR KFGASHEKLP GGILLSTKKR LKGASVHFPY PSVGATEQVL       180
     LTAVLADGVT ELRGAAIEPE IMDLIAILQK MGAIITCARD RVIFIEGVDS LSGYTHHAIS       240
     DRNEAASWAC AALATRGDIF VRNAEQAHLL AFLSVYRKVG GVFEIKDDGI RFFHPGGNLN       300
     PVVVETDVHP GFSTDWQQPL VVALTQASGR SVVHETVYES RFGFTEALNR MGADISVHEN       360
     GFQGTLRRVP HRAIEQAAVI NGPTPLTGQD IDVPDLRGGF SHFIAAFAAE GKSIITNAGI       420
     ISRGYENFVH KLERLKVDFE A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page