(data stored in ACNUC30630 zone)

EMBL: BX251410.PANC

BX251410.PANC        Location/Qualifiers
FT   CDS             64669..65535
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="TW073"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   pantoate--beta-alanine ligase PanC or cgl0113
FT                   SWALL:PANC_CORGL (SWALL:Q9X713) (279 aa) fasta scores: E():
FT                   1.5e-27, 39.59% id in 293 aa"
FT                   /db_xref="GOA:Q83ID9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83ID9"
FT                   /protein_id="CAD66760.1"
FT                   /translation="MNLKLASSPHELRTCLAGRAFVLVPTMGALHEGHIWLVDMARRCN
FT                   LPVVVSIFVNPLQFDDSLDLDTYPRTLEQDLEKLEGKAFAVYSPSVETMYPNGLDSIRI
FT                   DPGPIGRILEGAIRPGFFDGILTIVAKLLLQTAPERVFFSKKDAQQAFLVRRMVRELAF
FT                   PVRVEVTGFLRDKFSLPYSSRNRKLGVDAREKAQRLSQGLLSVVNNGPLTVRDCIDKIT
FT                   DLANSIGVDLGYAQILDENFCEIASDRMVTRAFHSEACIGLNTPLFLLAARVHGVRVVD
FT                   NVDLVVV"
     MNLKLASSPH ELRTCLAGRA FVLVPTMGAL HEGHIWLVDM ARRCNLPVVV SIFVNPLQFD        60
     DSLDLDTYPR TLEQDLEKLE GKAFAVYSPS VETMYPNGLD SIRIDPGPIG RILEGAIRPG       120
     FFDGILTIVA KLLLQTAPER VFFSKKDAQQ AFLVRRMVRE LAFPVRVEVT GFLRDKFSLP       180
     YSSRNRKLGV DAREKAQRLS QGLLSVVNNG PLTVRDCIDK ITDLANSIGV DLGYAQILDE       240
     NFCEIASDRM VTRAFHSEAC IGLNTPLFLL AARVHGVRVV DNVDLVVV                    288
//

If you have problems or comments...

PBIL Back to PBIL home page