(data stored in ACNUC30630 zone)

EMBL: BX251410.PCCB

BX251410.PCCB        Location/Qualifiers
FT   CDS             complement(24099..25676)
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="TW025"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.3"
FT                   /note="Similar to Saccharopolyspora erythraea propionyl-CoA
FT                   carboxylase beta chain PccB SWALL:PCCB_SACER (SWALL:P53003)
FT                   (546 aa) fasta scores: E(): 8.9e-123, 62.5% id in 520 aa"
FT                   /protein_id="CAD66717.1"
FT                   /translation="MTDNFDESSRGLEKYRQAYEVAVTLREDSAKEKQHSKGKMTARER
FT                   IDKLLDENSFTEIDQFAMHSASGFGIEKNHPYGDSVVTGFGSIDGRKVAVYSQDFTVFG
FT                   GSLGEVAGRKIVKTMDLAMSAGIPVIGLLDSGGARIQEGIAALTKYGEIFKRNVAASGI
FT                   IPQISIVMGPAAGGACYSPALTDFVIMVDQISYMFITGPDVIKAVTGEEVTFEDLGGAN
FT                   MHNATSGVSHYMAHSEDDAIAYARELIGFLPSNNMSDPPTWPQDIHTEESDLELNSIVP
FT                   ENPNKPYDMQFVIERIVDDGNFLEIQSAYAKNVIIGFARISGFSIGIVANQPAHMAGAL
FT                   DINASEKAARFVRFCDAFSIPILTLVDVPGYLPGTEQEWTGIIRRGAKLLYAYSEATVP
FT                   MVTIILRKAYGGAYIVMGSKALGADINLAWPSAEIAVMGAQGAVNILYRNDIKRLVQAG
FT                   EDANPMKEKLVKEYTDKFANPFIAAQRGYLDAIIEPAQTRIAIATAFQTIRTKRYKQID
FT                   RKHGSIPL"
     MTDNFDESSR GLEKYRQAYE VAVTLREDSA KEKQHSKGKM TARERIDKLL DENSFTEIDQ        60
     FAMHSASGFG IEKNHPYGDS VVTGFGSIDG RKVAVYSQDF TVFGGSLGEV AGRKIVKTMD       120
     LAMSAGIPVI GLLDSGGARI QEGIAALTKY GEIFKRNVAA SGIIPQISIV MGPAAGGACY       180
     SPALTDFVIM VDQISYMFIT GPDVIKAVTG EEVTFEDLGG ANMHNATSGV SHYMAHSEDD       240
     AIAYARELIG FLPSNNMSDP PTWPQDIHTE ESDLELNSIV PENPNKPYDM QFVIERIVDD       300
     GNFLEIQSAY AKNVIIGFAR ISGFSIGIVA NQPAHMAGAL DINASEKAAR FVRFCDAFSI       360
     PILTLVDVPG YLPGTEQEWT GIIRRGAKLL YAYSEATVPM VTIILRKAYG GAYIVMGSKA       420
     LGADINLAWP SAEIAVMGAQ GAVNILYRND IKRLVQAGED ANPMKEKLVK EYTDKFANPF       480
     IAAQRGYLDA IIEPAQTRIA IATAFQTIRT KRYKQIDRKH GSIPL                       525
//

If you have problems or comments...

PBIL Back to PBIL home page