(data stored in ACNUC30630 zone)

EMBL: BX251410.PE100

BX251410.PE100       Location/Qualifiers
FT   CDS             complement(110016..110624)
FT                   /transl_table=11
FT                   /locus_tag="TW109"
FT                   /product="putative NUDIX hydrolase"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein sco1775 sco1775 or sci51.15C SWALL:Q9S225
FT                   (EMBL:AL109848) (211 aa) fasta scores: E(): 6e-27, 46.74%
FT                   id in 169 aa, and to Bacillus subtilis adp-ribose
FT                   pyrophosphatase nudF SWALL:ADPP_BACSU (SWALL:P54570) (185
FT                   aa) fasta scores: E(): 1.1e-13, 33.15% id in 184 aa"
FT                   /protein_id="CAD66792.1"
FT                   /translation="MHYRVLESTLLHKGAVWDVVQEKLDYRGETISREFVSHPGAVGVL
FT                   ALNDKNEALLIRQYRHPIRTREWEIPAGMLDLSGESPLDAAKRELSEEVDMCAQTWHTL
FT                   IDFTLTPGGSNEVMRVYLARELRASQAKFNRKSEEADMEIAWIPMEDLLFSVLTRRVQN
FT                   PVLMLAALAAHEGLQVQWKYLRDADEPWPVYERLKGLIS"
     MHYRVLESTL LHKGAVWDVV QEKLDYRGET ISREFVSHPG AVGVLALNDK NEALLIRQYR        60
     HPIRTREWEI PAGMLDLSGE SPLDAAKREL SEEVDMCAQT WHTLIDFTLT PGGSNEVMRV       120
     YLARELRASQ AKFNRKSEEA DMEIAWIPME DLLFSVLTRR VQNPVLMLAA LAAHEGLQVQ       180
     WKYLRDADEP WPVYERLKGL IS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page