(data stored in ACNUC30630 zone)

EMBL: BX251410.PE103

BX251410.PE103       Location/Qualifiers
FT   CDS             complement(116812..117729)
FT                   /transl_table=11
FT                   /locus_tag="TW112"
FT                   /product="putative ATP-NAD kinase"
FT                   /note="Similar to Streptomyces coelicolor probable
FT                   inorganic polyphosphate/ATP-NAD kinase PpnK or SCO1781 or
FT                   SCI51.21c SWALL:PPNK_STRCO (SWALL:Q9S219) (301 aa) fasta
FT                   scores: E(): 1.2e-29, 39.09% id in 220 aa"
FT                   /db_xref="GOA:Q83IC3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC3"
FT                   /protein_id="CAD66795.1"
FT                   /translation="MRVYIAHNGCLEAEPIYGTICELVAQRKMSVITDPHARNNESARN
FT                   TDSGVVSLNQAGRNKYLDQETTSPATSRSINVPFCAGISIGGDGTFLRMARDLKNTGTP
FT                   LFGVNMGRMGFLVDIEPEDIVNLVENIVKGEYTEEKRLPITASVQRGGKKIHDEWAVNE
FT                   ITIERKVEGKVVDIEVFVDGCRVMDISCNGIIIATATGSTAYSFSSGGPIVWPEMKVTL
FT                   VVPVSPHELFAKPIVLPDNRSILLKVTSRDNKVVLCSDGQVRLCLQSGDEIACHVGKVP
FT                   VVFGRVKKGCFAEHLVKKFNLQTA"
     MRVYIAHNGC LEAEPIYGTI CELVAQRKMS VITDPHARNN ESARNTDSGV VSLNQAGRNK        60
     YLDQETTSPA TSRSINVPFC AGISIGGDGT FLRMARDLKN TGTPLFGVNM GRMGFLVDIE       120
     PEDIVNLVEN IVKGEYTEEK RLPITASVQR GGKKIHDEWA VNEITIERKV EGKVVDIEVF       180
     VDGCRVMDIS CNGIIIATAT GSTAYSFSSG GPIVWPEMKV TLVVPVSPHE LFAKPIVLPD       240
     NRSILLKVTS RDNKVVLCSD GQVRLCLQSG DEIACHVGKV PVVFGRVKKG CFAEHLVKKF       300
     NLQTA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page