(data stored in ACNUC30630 zone)

EMBL: BX251410.PE104

BX251410.PE104       Location/Qualifiers
FT   CDS             complement(117757..124683)
FT                   /transl_table=11
FT                   /locus_tag="TW113"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66796.1"
FT                   /translation="MVDTKKTYSVLPVVASLTAVTLITSGLYINPQTYTHAAEQTKEAS
FT                   QQPVDLPGRDIWLPKHISTTEQAKAFAAYFTEKTHLPTHVSGTDVYVKTYAGPDKITGT
FT                   ISFTSSSSTTPATGKYPSAVSFLNSGDHKGWLKVSPGSLTSDVSGTYTATAEYKSADSS
FT                   TVLSASYTFHVYDEYAVTLVTRGEASLTSALKTQYSGGLSLFGTVSQRPPACRGVDCVH
FT                   NNQLSIPQGLQLVNPVQGILGGTVTAAPGYYTFGLVDSTKRSTATINDIVAVVEMIVQE
FT                   HPTLDSADISVGPGSQVSYDQRPFPGRTLGGPDVTYTLTDQKPDKKPGQEIEEGKYTLP
FT                   SGLSFNSTTGRISGTVSKTQQAHTYPLTVRTHQNYGELAKLFDLKPSQAVATIVISVVT
FT                   PPRVTYGTTTIDSSTGTITSAIPTNLDSQALKFSIRTKPYGLDALSIDTFTGALRGNID
FT                   SGNRLYPVPPEGVYRVVVEAKNQLGQSAYFDAPVTVGEHVSFVGRPIPSDPLDKNRTHV
FT                   VAGVAYSLSPASGNQDNPLSQPTSVSYYRLADGTNQNATTPGSDSLPKGLSLNPNTGTI
FT                   SGTVASTGDEIPASGTYSFRVIAVSLGGEKTEVTYTLRVEQPFVAGNSTVYVSTDQTLD
FT                   KTTGVLTGIVGGTDVTVSLPQGTNQNATTPGSNSLPKGLSLSVSGTGESSTASARSVHL
FT                   TGKPDGSVAPGRYLTRLSVTSGGVTKTVVLVVVVTKLALKDKARAELETQNISVYHQEG
FT                   QPSDPIYVSPPALTGVDGETVIYTLKSGSTLPAGLSLGHEGRLTGRLLGATGVSQFTVT
FT                   ISTRHSKSSIDLTYKITHLPVSLGKQTVTTSQGGTIVLPPSVTGLTTAGTYSIGEPDPK
FT                   SKKKKPEEGATSPDTHDKLPKGLHLSHETGTIYGVIDKTVKTGVYSFPLTLTYGDDKNK
FT                   KSVSAVVEIYVTQGDPIITPKNLVYYKGDTNPVKVKTLDGQDFSGLPITPTATDTNTYT
FT                   WSLYDSGSTEGTGIIPADNTLPRGLSLDKSTGKITGTIDSSVEYGTYTFRLRATNATGG
FT                   YGVADISLIYVTKPHTTPISPVTNPVYAAPGGRVSIPQLDGKGGFKYTLVDARDQAETV
FT                   KKSDGPVQFGLPTGLSLNPETGYVSGTVGKTVLPGTYVFGVKVSADSLDTGRFPGSSET
FT                   IYYALTVTTRPVLESVDGPVYKSHHVTIPANLLNAGTGTTFSLSGSSSIDPGVNRYPQG
FT                   LSIDQSTGTLTGSVSSANPGSYTFRVLATTDGVSTEALYHLTVKTPPPFPTTTYSVVAG
FT                   YTPHTTGREPLKDRFSVYLDLSRKYPSYTWTFGRDTVQGTTPGENTVPLGLVLYSSEGA
FT                   LIGNVDKSVKPGLYSFDLVALDNGQYVSSLRVEITVFELDAVEYPENTLVKPGQQVSIT
FT                   PKVPTDLDQARKLTITAGSGAVPSLKPGDGRLPLGLTITKPSLTSSSKTSDGLGAIQGV
FT                   VDPRVEAGEYTAHIDVFQATGEQIPVGARRTVLVKIRVEGQATLLSPTQLVVTKQGASV
FT                   SFFPHIAGGQTFAFANGTSSSITPGPNRVPAGLGINPDTGLVQGTLGTDVEAGRYTFGI
FT                   TATGSQGTSPVTLQVTLLVSAIESRNYSVVAGRPVPVNKDTNTTGYTYALSSSSYSSVV
FT                   AGQGRIPRGITLDRTTGNITGTVGRTVAAGLYTFGVDVFSARGSRITTVMYSVSVTDVF
FT                   GTKPFSAAVTLGTQVSLPSGQDDGGSDFSFVNAAWSTTPGPNRVPRGVFLDPSTGSLKT
FT                   LNPLSGVQPGIYTFTLSFGPRGRRSSYLYTLAVLPPVTLSALQGDQITDEIAIPSGITL
FT                   SGLPKEYGIVVGADGSVTSKAITQPPGIYSLPYTTRYYGQPLYTSAPSTATLTVSSVSP
FT                   LSADVNDVNALFDKTPEESLKETLTFAFARGTSSSTTPGPNRVPAGLGIAGPTGRVAGF
FT                   FKTGIQNGVYTFTVDISTQSGKYLGSRLYTITIGAPGIDATVNLVKIAGIYQSTSPVIF
FT                   FPPTQEGTYSLSSTATYSATPGPNRVPLGLLLGRADGSLTGSVYGSSPGVYTFLVESTY
FT                   GQQLYRLTLKDTTPPPSHTQSAKPTEKPKEEKTPTESKGGGFWSKVGSGIAAPFKWIWH
FT                   GITWPFRKLFGSRSEAPSSTTNATGNTNGKTRVKRDTQKPPEHPLKSVNEQIKTVTGAV
FT                   NNFQKSVLTSLKDFFTYLTDTAHLKFLNSTKTGLTKINGWVTGITGPVNKYIDKIRDWG
FT                   LLDKDHKTTGTTLKVLEAVVNPLTSWLPSPLQVLASNVLESKGLVTWTKGTATKLICLI
FT                   PWIKTLPLCPADSGNSDKSSK"
     MVDTKKTYSV LPVVASLTAV TLITSGLYIN PQTYTHAAEQ TKEASQQPVD LPGRDIWLPK        60
     HISTTEQAKA FAAYFTEKTH LPTHVSGTDV YVKTYAGPDK ITGTISFTSS SSTTPATGKY       120
     PSAVSFLNSG DHKGWLKVSP GSLTSDVSGT YTATAEYKSA DSSTVLSASY TFHVYDEYAV       180
     TLVTRGEASL TSALKTQYSG GLSLFGTVSQ RPPACRGVDC VHNNQLSIPQ GLQLVNPVQG       240
     ILGGTVTAAP GYYTFGLVDS TKRSTATIND IVAVVEMIVQ EHPTLDSADI SVGPGSQVSY       300
     DQRPFPGRTL GGPDVTYTLT DQKPDKKPGQ EIEEGKYTLP SGLSFNSTTG RISGTVSKTQ       360
     QAHTYPLTVR THQNYGELAK LFDLKPSQAV ATIVISVVTP PRVTYGTTTI DSSTGTITSA       420
     IPTNLDSQAL KFSIRTKPYG LDALSIDTFT GALRGNIDSG NRLYPVPPEG VYRVVVEAKN       480
     QLGQSAYFDA PVTVGEHVSF VGRPIPSDPL DKNRTHVVAG VAYSLSPASG NQDNPLSQPT       540
     SVSYYRLADG TNQNATTPGS DSLPKGLSLN PNTGTISGTV ASTGDEIPAS GTYSFRVIAV       600
     SLGGEKTEVT YTLRVEQPFV AGNSTVYVST DQTLDKTTGV LTGIVGGTDV TVSLPQGTNQ       660
     NATTPGSNSL PKGLSLSVSG TGESSTASAR SVHLTGKPDG SVAPGRYLTR LSVTSGGVTK       720
     TVVLVVVVTK LALKDKARAE LETQNISVYH QEGQPSDPIY VSPPALTGVD GETVIYTLKS       780
     GSTLPAGLSL GHEGRLTGRL LGATGVSQFT VTISTRHSKS SIDLTYKITH LPVSLGKQTV       840
     TTSQGGTIVL PPSVTGLTTA GTYSIGEPDP KSKKKKPEEG ATSPDTHDKL PKGLHLSHET       900
     GTIYGVIDKT VKTGVYSFPL TLTYGDDKNK KSVSAVVEIY VTQGDPIITP KNLVYYKGDT       960
     NPVKVKTLDG QDFSGLPITP TATDTNTYTW SLYDSGSTEG TGIIPADNTL PRGLSLDKST      1020
     GKITGTIDSS VEYGTYTFRL RATNATGGYG VADISLIYVT KPHTTPISPV TNPVYAAPGG      1080
     RVSIPQLDGK GGFKYTLVDA RDQAETVKKS DGPVQFGLPT GLSLNPETGY VSGTVGKTVL      1140
     PGTYVFGVKV SADSLDTGRF PGSSETIYYA LTVTTRPVLE SVDGPVYKSH HVTIPANLLN      1200
     AGTGTTFSLS GSSSIDPGVN RYPQGLSIDQ STGTLTGSVS SANPGSYTFR VLATTDGVST      1260
     EALYHLTVKT PPPFPTTTYS VVAGYTPHTT GREPLKDRFS VYLDLSRKYP SYTWTFGRDT      1320
     VQGTTPGENT VPLGLVLYSS EGALIGNVDK SVKPGLYSFD LVALDNGQYV SSLRVEITVF      1380
     ELDAVEYPEN TLVKPGQQVS ITPKVPTDLD QARKLTITAG SGAVPSLKPG DGRLPLGLTI      1440
     TKPSLTSSSK TSDGLGAIQG VVDPRVEAGE YTAHIDVFQA TGEQIPVGAR RTVLVKIRVE      1500
     GQATLLSPTQ LVVTKQGASV SFFPHIAGGQ TFAFANGTSS SITPGPNRVP AGLGINPDTG      1560
     LVQGTLGTDV EAGRYTFGIT ATGSQGTSPV TLQVTLLVSA IESRNYSVVA GRPVPVNKDT      1620
     NTTGYTYALS SSSYSSVVAG QGRIPRGITL DRTTGNITGT VGRTVAAGLY TFGVDVFSAR      1680
     GSRITTVMYS VSVTDVFGTK PFSAAVTLGT QVSLPSGQDD GGSDFSFVNA AWSTTPGPNR      1740
     VPRGVFLDPS TGSLKTLNPL SGVQPGIYTF TLSFGPRGRR SSYLYTLAVL PPVTLSALQG      1800
     DQITDEIAIP SGITLSGLPK EYGIVVGADG SVTSKAITQP PGIYSLPYTT RYYGQPLYTS      1860
     APSTATLTVS SVSPLSADVN DVNALFDKTP EESLKETLTF AFARGTSSST TPGPNRVPAG      1920
     LGIAGPTGRV AGFFKTGIQN GVYTFTVDIS TQSGKYLGSR LYTITIGAPG IDATVNLVKI      1980
     AGIYQSTSPV IFFPPTQEGT YSLSSTATYS ATPGPNRVPL GLLLGRADGS LTGSVYGSSP      2040
     GVYTFLVEST YGQQLYRLTL KDTTPPPSHT QSAKPTEKPK EEKTPTESKG GGFWSKVGSG      2100
     IAAPFKWIWH GITWPFRKLF GSRSEAPSST TNATGNTNGK TRVKRDTQKP PEHPLKSVNE      2160
     QIKTVTGAVN NFQKSVLTSL KDFFTYLTDT AHLKFLNSTK TGLTKINGWV TGITGPVNKY      2220
     IDKIRDWGLL DKDHKTTGTT LKVLEAVVNP LTSWLPSPLQ VLASNVLESK GLVTWTKGTA      2280
     TKLICLIPWI KTLPLCPADS GNSDKSSK                                         2308
//

If you have problems or comments...

PBIL Back to PBIL home page