(data stored in ACNUC30630 zone)

EMBL: BX251410.PE11

BX251410.PE11        Location/Qualifiers
FT   CDS             11399..12037
FT                   /transl_table=11
FT                   /locus_tag="TW011"
FT                   /product="putative glutamine amidotransferase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   glutamine amidotransferase SCO3851 or SCH69.21c
FT                   SWALL:Q9XA13 (EMBL:AL079308) (212 aa) fasta scores: E():
FT                   1.8e-29, 43.68% id in 206 aa, and to Escherichia coli
FT                   para-aminobenzoate synthase glutamine amidotransferase
FT                   component II PabA or b3360 SWALL:PABA_ECOLI (SWALL:P00903)
FT                   (187 aa) fasta scores: E(): 5e-24, 41.48% id in 188 aa"
FT                   /protein_id="CAD66703.1"
FT                   /translation="MFKVLVIDNHDSFIYTLVNYLQQLGVTTSVVRSDNNCHSVESMLG
FT                   VHDAALISPGPGTPEESGITLSVIRAAYSTSTPLLGVCLGHQALAVAFGGDIGPSGRIM
FT                   HGKLVTVRPRPSAIFKDLPTAFTATRYNSLTVTKVPQALRVIARADCGEVMALEHRTAP
FT                   MYGVQFHPESAVSEWGFRILGNWLYISGFNKALGISRDLPIVVYNTRVR"
     MFKVLVIDNH DSFIYTLVNY LQQLGVTTSV VRSDNNCHSV ESMLGVHDAA LISPGPGTPE        60
     ESGITLSVIR AAYSTSTPLL GVCLGHQALA VAFGGDIGPS GRIMHGKLVT VRPRPSAIFK       120
     DLPTAFTATR YNSLTVTKVP QALRVIARAD CGEVMALEHR TAPMYGVQFH PESAVSEWGF       180
     RILGNWLYIS GFNKALGISR DLPIVVYNTR VR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page