(data stored in ACNUC30630 zone)

EMBL: BX251410.PE117

BX251410.PE117       Location/Qualifiers
FT   CDS             132629..134734
FT                   /transl_table=11
FT                   /locus_tag="TW129"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   protein Rv0102 or mt0111 or mtcy251.21 SWALL:Y102_MYCTU
FT                   (SWALL:Q10897) (661 aa) fasta scores: E(): 8.5e-38, 31.79%
FT                   id in 478 aa, and to Streptomyces coelicolor putative
FT                   integral membrane protein SCO1215 or 2SCG58.15 SWALL:Q9FC98
FT                   (EMBL:AL391017) (316 aa) fasta scores: E(): 3.3e-37, 40.13%
FT                   id in 304 aa"
FT                   /protein_id="CAD66809.1"
FT                   /translation="MARLLSARFFSILIVFFALSFFLASFVLPRLLGGFDINWALVSVT
FT                   GALRFLVAILVGCLVSIAYSLSPRFPEYGKLLIVARTLSCCVVPVVFFCILFAFLTEKA
FT                   EFSGLNFETYLTGPGFVWIIVLALVLLISLALLFCKKRIQIAVISTITLLLLIPLAFSE
FT                   HSGHSTVSANVSQHVTDYQGSVSDKSHHAHHSHNHSHNHSQGETRSAHDVPLDAIGASR
FT                   TPAMHGGSHGAMGASLVYAISISVLAGVIFSMLYITGLYFARIKHIKSSVQIMPQRFFS
FT                   ITNRLSVLSMFLLLFAFFSDAVTAMPYISSEFTPYGILSATKIALFLLLALCALYIHFF
FT                   YFIKSRMTCALIVILACEAVITGLIFLITASAVTQIPQASVSDRTPTPAELLTGQILPP
FT                   RESFTNYLSIWMIDPLWLSICVVLAFFYLLGVIKLHRRGDRWPWLKTVSWLFAVLVMFY
FT                   VTNGGVAVYGMYLFSAHMVMHMTLGAIVPIFLVVASPVTLLLRAVPARRDGSFGPREWI
FT                   LFFLNTRFIQFISLPPIAAAIFILSMFIFYFTDLLQFGIQNYLGHQVMMFHFLLSGYLF
FT                   AQSILVTDPSRHRFSIPSRMLVLVLAMATHAFFGIAIMSSRYLFLPEWFGAMGRTWGSP
FT                   PLVDQQMGGALAWGTTEIPTILLVTFLFFKWFKQDQREALRRDRAEDRNGDKALVAYNE
FT                   YLARLQG"
     MARLLSARFF SILIVFFALS FFLASFVLPR LLGGFDINWA LVSVTGALRF LVAILVGCLV        60
     SIAYSLSPRF PEYGKLLIVA RTLSCCVVPV VFFCILFAFL TEKAEFSGLN FETYLTGPGF       120
     VWIIVLALVL LISLALLFCK KRIQIAVIST ITLLLLIPLA FSEHSGHSTV SANVSQHVTD       180
     YQGSVSDKSH HAHHSHNHSH NHSQGETRSA HDVPLDAIGA SRTPAMHGGS HGAMGASLVY       240
     AISISVLAGV IFSMLYITGL YFARIKHIKS SVQIMPQRFF SITNRLSVLS MFLLLFAFFS       300
     DAVTAMPYIS SEFTPYGILS ATKIALFLLL ALCALYIHFF YFIKSRMTCA LIVILACEAV       360
     ITGLIFLITA SAVTQIPQAS VSDRTPTPAE LLTGQILPPR ESFTNYLSIW MIDPLWLSIC       420
     VVLAFFYLLG VIKLHRRGDR WPWLKTVSWL FAVLVMFYVT NGGVAVYGMY LFSAHMVMHM       480
     TLGAIVPIFL VVASPVTLLL RAVPARRDGS FGPREWILFF LNTRFIQFIS LPPIAAAIFI       540
     LSMFIFYFTD LLQFGIQNYL GHQVMMFHFL LSGYLFAQSI LVTDPSRHRF SIPSRMLVLV       600
     LAMATHAFFG IAIMSSRYLF LPEWFGAMGR TWGSPPLVDQ QMGGALAWGT TEIPTILLVT       660
     FLFFKWFKQD QREALRRDRA EDRNGDKALV AYNEYLARLQ G                           701
//

If you have problems or comments...

PBIL Back to PBIL home page