(data stored in ACNUC30630 zone)

EMBL: BX251410.PE118

BX251410.PE118       Location/Qualifiers
FT   CDS             134760..136832
FT                   /transl_table=11
FT                   /locus_tag="TW130"
FT                   /product="putative helicase regulator"
FT                   /note="Similar to Anabaena sp. hypothetical protein Alr4398
FT                   SWALL:Q8YP09 (EMBL:AP003596) (1075 aa) fasta scores: E():
FT                   9.6e-17, 26.54% id in 584 aa, and to Drosophila
FT                   melanogaster IswI protein or cg8625 SWALL:ISWI_DROME
FT                   (SWALL:Q24368) (1027 aa) fasta scores: E(): 2.3e-15, 26.16%
FT                   id in 474 aa"
FT                   /protein_id="CAD66810.1"
FT                   /translation="MTNAVIKDRTSHLLSALARTVREVEMSLVRKRIGPSSVMRFHAVA
FT                   LLLRQERARVKSDPDITDTVRTELIRRLDGLAAVMVRIAARDTALMSIVTPDAPVSDGA
FT                   LLYRRRLLSQIGVIDSDGESSEIREAAPPPPSLELYPQSVKMYHATHIFRPPGPDMESD
FT                   LVPIIRLANWDLVGSVFKAFSQGGASVCKSLPAPSPFLDRLAPDGLSMMPHQAGFVESA
FT                   RLGHRSFLLADEPGLGKTAQSLLAAGVTNSFPLLVVVPNVVKLNWVREAKMWLPGRRAT
FT                   IISGDDLDAFADIFVINYEMLDRHMLWMVDFGFAGMVVDEAHLIKNFSSQRSGNVLALA
FT                   QHIRKKCCNPLMIALTGTPVINSVEDFRALWLFLGWLAGPRGRDLSPVFVSELEKTGLT
FT                   PEDPGFSETVRDVMGHLGIVRRRKTQVAKDLPERMVVDLPVELDGDAFRSVKNAEDDLA
FT                   DALYAQYISLKHLRIDDYQIRLKAVERFAVESKDSSALNIFSIVRKIGITKAPLAIDFT
FT                   IQMLDSVGKIVFFAKHIEVMNMAEEMFCQQGIRSVSIRGSQTPNDRKNALRTFDEDPDT
FT                   RVAICSLTAAGLGINLQVASNVVLSELSWTAAEQGQAIDRLHRIGQTEPVTAWRILGAG
FT                   TVDIRMAALVDSKSNDAILSLDGGDMREVQQESLHIRSLLDLLDDRIRKAEQHVE"
     MTNAVIKDRT SHLLSALART VREVEMSLVR KRIGPSSVMR FHAVALLLRQ ERARVKSDPD        60
     ITDTVRTELI RRLDGLAAVM VRIAARDTAL MSIVTPDAPV SDGALLYRRR LLSQIGVIDS       120
     DGESSEIREA APPPPSLELY PQSVKMYHAT HIFRPPGPDM ESDLVPIIRL ANWDLVGSVF       180
     KAFSQGGASV CKSLPAPSPF LDRLAPDGLS MMPHQAGFVE SARLGHRSFL LADEPGLGKT       240
     AQSLLAAGVT NSFPLLVVVP NVVKLNWVRE AKMWLPGRRA TIISGDDLDA FADIFVINYE       300
     MLDRHMLWMV DFGFAGMVVD EAHLIKNFSS QRSGNVLALA QHIRKKCCNP LMIALTGTPV       360
     INSVEDFRAL WLFLGWLAGP RGRDLSPVFV SELEKTGLTP EDPGFSETVR DVMGHLGIVR       420
     RRKTQVAKDL PERMVVDLPV ELDGDAFRSV KNAEDDLADA LYAQYISLKH LRIDDYQIRL       480
     KAVERFAVES KDSSALNIFS IVRKIGITKA PLAIDFTIQM LDSVGKIVFF AKHIEVMNMA       540
     EEMFCQQGIR SVSIRGSQTP NDRKNALRTF DEDPDTRVAI CSLTAAGLGI NLQVASNVVL       600
     SELSWTAAEQ GQAIDRLHRI GQTEPVTAWR ILGAGTVDIR MAALVDSKSN DAILSLDGGD       660
     MREVQQESLH IRSLLDLLDD RIRKAEQHVE                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page