(data stored in ACNUC30630 zone)

EMBL: BX251410.PE12

BX251410.PE12        Location/Qualifiers
FT   CDS             12143..12715
FT                   /transl_table=11
FT                   /locus_tag="TW012"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein SMC00853 or R00853 SWALL:Q92RL3
FT                   (EMBL:AL591785) (182 aa) fasta scores: E(): 6.7e-26, 49.18%
FT                   id in 183 aa"
FT                   /protein_id="CAD66704.1"
FT                   /translation="MDGVFLWVTLGLALAIVVIAIFAWVAYNRLVAYNVRVDEAWSDIT
FT                   VQLKRRADLIPSLIETVKGYASHEKSVFKQVTLARAASIGASGVAEAAAADNQLQAALK
FT                   SIFAVAEAYPQLQASQNFLDLQAQLTDTENKIQASRRFYNGGVRDLNTLIGVFPSNIVA
FT                   RIAKFSTREFFDVERSEALQSPPKIVF"
     MDGVFLWVTL GLALAIVVIA IFAWVAYNRL VAYNVRVDEA WSDITVQLKR RADLIPSLIE        60
     TVKGYASHEK SVFKQVTLAR AASIGASGVA EAAAADNQLQ AALKSIFAVA EAYPQLQASQ       120
     NFLDLQAQLT DTENKIQASR RFYNGGVRDL NTLIGVFPSN IVARIAKFST REFFDVERSE       180
     ALQSPPKIVF                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page