(data stored in ACNUC30630 zone)

EMBL: BX251410.PE120

BX251410.PE120       Location/Qualifiers
FT   CDS             complement(138453..140111)
FT                   /transl_table=11
FT                   /locus_tag="TW132"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66812.1"
FT                   /translation="MIAYWGMIFGVVVLATLLRFYNLSDPKTLIFDETYYVKDAYTLYK
FT                   NGYESEWPRDMKPEDIDKRFVSGDTDFFTNEPEFLAHPHLGKYIIGAGIELFGVRSQFG
FT                   WRIAVALIGVLGVFMTAVIAARLFESTLIGGIAGFLFAIENNAIVMSRVAILDNVLMII
FT                   SLIAVWCVLLDRQWYRKAMSKWVQNRSKHLSQDAKGNYLVSGPLVWWRPWLALAAVLMG
FT                   MAASVKWSGIFYYFGIIPYITAIDWTTRKQLGIKYRFQGTFYQVLVSGISSVIISVFVY
FT                   IALWANYFIVGGWGSSWATYPGNGWAGPLAWVPKIFQSWVNFQVTMYRFNSTLTTPHIY
FT                   EAPVYTWPFLIRPTNMYWTKIGDDVRVIIGLPNPLLWWAAVALFIIFALIAIFAPSRRD
FT                   WRMNFILMTLAGGYFPWFLYVNRTIFHFYTIVFEPFMIIMIAAAIYKILEIKTENRLLP
FT                   TPWVGTRRFEYGSRVLAALRGSGNRVREACFVMPARIASLDIAPVMQAPLLRLMLVVTF
FT                   LLAATVCGFVILPINMAWPVHYKYWESLMILPSWK"
     MIAYWGMIFG VVVLATLLRF YNLSDPKTLI FDETYYVKDA YTLYKNGYES EWPRDMKPED        60
     IDKRFVSGDT DFFTNEPEFL AHPHLGKYII GAGIELFGVR SQFGWRIAVA LIGVLGVFMT       120
     AVIAARLFES TLIGGIAGFL FAIENNAIVM SRVAILDNVL MIISLIAVWC VLLDRQWYRK       180
     AMSKWVQNRS KHLSQDAKGN YLVSGPLVWW RPWLALAAVL MGMAASVKWS GIFYYFGIIP       240
     YITAIDWTTR KQLGIKYRFQ GTFYQVLVSG ISSVIISVFV YIALWANYFI VGGWGSSWAT       300
     YPGNGWAGPL AWVPKIFQSW VNFQVTMYRF NSTLTTPHIY EAPVYTWPFL IRPTNMYWTK       360
     IGDDVRVIIG LPNPLLWWAA VALFIIFALI AIFAPSRRDW RMNFILMTLA GGYFPWFLYV       420
     NRTIFHFYTI VFEPFMIIMI AAAIYKILEI KTENRLLPTP WVGTRRFEYG SRVLAALRGS       480
     GNRVREACFV MPARIASLDI APVMQAPLLR LMLVVTFLLA ATVCGFVILP INMAWPVHYK       540
     YWESLMILPS WK                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page