(data stored in ACNUC30630 zone)

EMBL: BX251410.PE122

BX251410.PE122       Location/Qualifiers
FT   CDS             142042..142350
FT                   /transl_table=11
FT                   /locus_tag="TW134"
FT                   /product="WhiB-like regulatory protein"
FT                   /note="Similar to Streptomyces griseocarneus WhiB-STV
FT                   protein SWALL:Q06387 (EMBL:X68708) (87 aa) fasta scores:
FT                   E(): 1.6e-20, 80% id in 70 aa, and to Streptomyces
FT                   coelicolor regulatory protein WhiB or SCO3034 or SCE34.15C
FT                   SWALL:Q53963 (EMBL:X62287) (87 aa) fasta scores: E():
FT                   1.6e-20, 80% id in 70 aa"
FT                   /protein_id="CAD66814.1"
FT                   /translation="MSDNLPIPDDWHIDPVLLGIPGLRGGFDWRARALCAQADPESFFP
FT                   EKGGSTREAKKVCSSCAVRSECLEYALENDERYGIWGGTSERERRILRQRRAASGLA"
     MSDNLPIPDD WHIDPVLLGI PGLRGGFDWR ARALCAQADP ESFFPEKGGS TREAKKVCSS        60
     CAVRSECLEY ALENDERYGI WGGTSERERR ILRQRRAASG LA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page