(data stored in ACNUC30630 zone)

EMBL: BX251410.PE123

BX251410.PE123       Location/Qualifiers
FT   CDS             142512..144908
FT                   /transl_table=11
FT                   /locus_tag="TW135"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces aureofaciens transmembrane
FT                   protein WhiB2 SWALL:Q53785 (EMBL:L22864) (1219 aa) fasta
FT                   scores: E(): 1.5e-06, 21.76% id in 896 aa, and to
FT                   Streptomyces coelicolor putative integral membrane protein
FT                   SCO3033 or SCE34.14c SWALL:Q9KZL1 (EMBL:AL353862) (1268 aa)
FT                   fasta scores: E(): 2e-06, 24.06% id in 939 aa"
FT                   /protein_id="CAD66815.1"
FT                   /translation="MRFPPGYNRARALNAACLKCPDTDFYWFLNTRIVAAPTALEYLLN
FT                   TIEVSPGASVAAPKILNDTGVFFDYGQSITTGGRAVHLVQDELDQGQHDDKVDTMGANY
FT                   AGMLVHRSCFEAIKGFDPGFSEYEQGLDFCIRARLSGARVSLSPRSVVTHVGTGLRSYR
FT                   VQEGYIQKRTGQLRRQIVYAPFVKSVLLWFSLIPRGVLWFLASLLTRRSALKEAWAHIK
FT                   LAFLPISLARSRKISNRQNSLRALSVLMQKPKREFMSYEKLDFFFRNGLVIVLIFVFIG
FT                   FVVFLPFLAHPALSGGSLLPINLSFYQMWRMTAVYVFLDGVYPADPFNIIPALLGSLTF
FT                   WDTNFSILLLYFVALPLSCTAAWLCASRLLSSPRTIAFSAALYSLSPSLWLGLYNGNLQ
FT                   GIVVHICLPFLCFLMLGIKTFRTLSLASLLFAFITVASPSIFLPLTVLVLIVAIATATF
FT                   RMLFIVLPVIVAFIPLFLVQPLRVNLLADPVLSSTNLFSSIFGLGNIFTTAHLSLFLLV
FT                   LPIIFLILMGLWKTYSSLPFLLITFVGFVNSVIWADVWQGPSFSLAWLGITGAAAIGFT
FT                   SIRCIKRMIALVSVGALGAFFVYIPYATKIWQAQSPVVSTTSAVNLPAYVLAEANSNSN
FT                   IGTLIVEPVSEKEIRVKVARGAVFGFGSQNTKLISGANPQSSDLANLAVNLVMSGNVDI
FT                   AEGMKRLNLEMLLLSGDKYGFSANINANSMFEAAGNTPFGKLWRLKDRLPPLGQATFPP
FT                   YYWLSPIVFLLLFLVGVFGRSSRKPPEEMGIDLEDQFAEPGYALT"
     MRFPPGYNRA RALNAACLKC PDTDFYWFLN TRIVAAPTAL EYLLNTIEVS PGASVAAPKI        60
     LNDTGVFFDY GQSITTGGRA VHLVQDELDQ GQHDDKVDTM GANYAGMLVH RSCFEAIKGF       120
     DPGFSEYEQG LDFCIRARLS GARVSLSPRS VVTHVGTGLR SYRVQEGYIQ KRTGQLRRQI       180
     VYAPFVKSVL LWFSLIPRGV LWFLASLLTR RSALKEAWAH IKLAFLPISL ARSRKISNRQ       240
     NSLRALSVLM QKPKREFMSY EKLDFFFRNG LVIVLIFVFI GFVVFLPFLA HPALSGGSLL       300
     PINLSFYQMW RMTAVYVFLD GVYPADPFNI IPALLGSLTF WDTNFSILLL YFVALPLSCT       360
     AAWLCASRLL SSPRTIAFSA ALYSLSPSLW LGLYNGNLQG IVVHICLPFL CFLMLGIKTF       420
     RTLSLASLLF AFITVASPSI FLPLTVLVLI VAIATATFRM LFIVLPVIVA FIPLFLVQPL       480
     RVNLLADPVL SSTNLFSSIF GLGNIFTTAH LSLFLLVLPI IFLILMGLWK TYSSLPFLLI       540
     TFVGFVNSVI WADVWQGPSF SLAWLGITGA AAIGFTSIRC IKRMIALVSV GALGAFFVYI       600
     PYATKIWQAQ SPVVSTTSAV NLPAYVLAEA NSNSNIGTLI VEPVSEKEIR VKVARGAVFG       660
     FGSQNTKLIS GANPQSSDLA NLAVNLVMSG NVDIAEGMKR LNLEMLLLSG DKYGFSANIN       720
     ANSMFEAAGN TPFGKLWRLK DRLPPLGQAT FPPYYWLSPI VFLLLFLVGV FGRSSRKPPE       780
     EMGIDLEDQF AEPGYALT                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page