(data stored in ACNUC30630 zone)

EMBL: BX251410.PE124

BX251410.PE124       Location/Qualifiers
FT   CDS             144961..146340
FT                   /transl_table=11
FT                   /locus_tag="TW136"
FT                   /product="putative secreted protein"
FT                   /note="Similar to Streptomyces coelicolor putative secreted
FT                   protein SCO3032 or SCE34.13c SWALL:Q9KZL2 (EMBL:AL353862)
FT                   (506 aa) fasta scores: E(): 0.01, 24.83% id in 294 aa"
FT                   /protein_id="CAD66816.1"
FT                   /translation="MKIFPKILNCFILVLLPAIVFLFSGVHITTAVGVRHKTKVTSIEL
FT                   RLSCPGSLVGVGGVHARGISFVPLGNPSVLYAASQAGLLKAEHPSGVMLRGGYGTSGSQ
FT                   IQGLSSDRVKGLAAASCQQPRQESWLLGGATGVFDNTLLILGNPSDSQTSVSFTVYSGN
FT                   EKKFSSGVPVPSRSLRFVNLAGIAPGLSRIAVQVKSDDVPVYSVLQHSIVKGAVPMGVS
FT                   YVSTGNIDKSQYIPGVIINDNTINDNDNPQILLRLFVPGKDDADVSVSVVSKTTPGTAL
FT                   TAHVTGGSIRDIPISGLTSSSYFISITSSKPLLASALSSMSFQSGARDFAWYPATHATS
FT                   ADTFIAVPSRGVLALQNTLDQSQSVKLESLNGFSDSFPSGFVNTSHVFVPKQPEVTNST
FT                   VIHLDRSGVATHPVSRGFYRLSHKGQVAFSLAFVNSEGIAMYNPPTGDTRPDGITVDVL
FT                   Q"
     MKIFPKILNC FILVLLPAIV FLFSGVHITT AVGVRHKTKV TSIELRLSCP GSLVGVGGVH        60
     ARGISFVPLG NPSVLYAASQ AGLLKAEHPS GVMLRGGYGT SGSQIQGLSS DRVKGLAAAS       120
     CQQPRQESWL LGGATGVFDN TLLILGNPSD SQTSVSFTVY SGNEKKFSSG VPVPSRSLRF       180
     VNLAGIAPGL SRIAVQVKSD DVPVYSVLQH SIVKGAVPMG VSYVSTGNID KSQYIPGVII       240
     NDNTINDNDN PQILLRLFVP GKDDADVSVS VVSKTTPGTA LTAHVTGGSI RDIPISGLTS       300
     SSYFISITSS KPLLASALSS MSFQSGARDF AWYPATHATS ADTFIAVPSR GVLALQNTLD       360
     QSQSVKLESL NGFSDSFPSG FVNTSHVFVP KQPEVTNSTV IHLDRSGVAT HPVSRGFYRL       420
     SHKGQVAFSL AFVNSEGIAM YNPPTGDTRP DGITVDVLQ                              459
//

If you have problems or comments...

PBIL Back to PBIL home page