(data stored in ACNUC30630 zone)

EMBL: BX251410.PE126

BX251410.PE126       Location/Qualifiers
FT   CDS             148563..149258
FT                   /transl_table=11
FT                   /locus_tag="TW138"
FT                   /product="conserved hypothetical protein (possible
FT                   ATP-binding)"
FT                   /note="Similar to Corynebacterium glutamicum predicted
FT                   amidophosphoribosyltransferases Cgl0757 SWALL:BAB98150
FT                   (EMBL:AP005276) (196 aa) fasta scores: E(): 4.4e-06, 23.98%
FT                   id in 196 aa, and to Deinococcus radiodurans competence
FT                   protein ComF, putative dr1389 SWALL:Q9RUJ7 (EMBL:AE001984)
FT                   (219 aa) fasta scores: E(): 2.2e-05, 27.17% id in 195 aa"
FT                   /protein_id="CAD66818.1"
FT                   /translation="MSNLFYPTSCPCCGMQDTTLCDLCFARLAERPYRESLAGLDVISC
FT                   CDYTPTARAFITAYKVMKRMTLAKFMGLIIANQLNVFSSEYGNYSVITMPSTRLSWRSR
FT                   GFHPVDHALKTIGVEPVDLLCFRKQPKDQAFLDRRERMANMFGTLQVKKISTYSKNLLF
FT                   VDDVMTSAATLLEVHRAVSLTGKTLIGAVVLFRTRAKYPLGYNVRNKRSDSQSLKCTNH
FT                   FIPTFSITR"
     MSNLFYPTSC PCCGMQDTTL CDLCFARLAE RPYRESLAGL DVISCCDYTP TARAFITAYK        60
     VMKRMTLAKF MGLIIANQLN VFSSEYGNYS VITMPSTRLS WRSRGFHPVD HALKTIGVEP       120
     VDLLCFRKQP KDQAFLDRRE RMANMFGTLQ VKKISTYSKN LLFVDDVMTS AATLLEVHRA       180
     VSLTGKTLIG AVVLFRTRAK YPLGYNVRNK RSDSQSLKCT NHFIPTFSIT R                231
//

If you have problems or comments...

PBIL Back to PBIL home page