(data stored in ACNUC30630 zone)

EMBL: BX251410.PE128

BX251410.PE128       Location/Qualifiers
FT   CDS             152632..152805
FT                   /transl_table=11
FT                   /locus_tag="TW140"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66820.1"
FT                   /translation="MFLETLREHCRRCRLHTPHTIAEGVVTGVHKDHVHLKKDIDHELF
FT                   FPICNLIAIELL"
     MFLETLREHC RRCRLHTPHT IAEGVVTGVH KDHVHLKKDI DHELFFPICN LIAIELL           57
//

If you have problems or comments...

PBIL Back to PBIL home page