(data stored in ACNUC30630 zone)

EMBL: BX251410.PE129

BX251410.PE129       Location/Qualifiers
FT   CDS             152950..153696
FT                   /transl_table=11
FT                   /locus_tag="TW141"
FT                   /product="putative membrane/secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66821.1"
FT                   /translation="MKIRSKWFPDTRILIGLALIAASFIGVFFVIKTNNSKSQVYVATR
FT                   PLSIGDKFDAKQFSIVEANLGANLDKYITPGSLPNAVFNRPIMPGEFLPKSALVPVIDK
FT                   DIVAVVLRIAGDLPGDVKEGDLVDVWAAVKIKEEGFWQSELIAKTLRVSRVIVSTSQFD
FT                   PRGTTKVEVQASRDRLSYLLNAIANQDKVSIVRASHKEIELLRSASTPRTLDEQDKQNV
FT                   GETPDTNPRGPDEKDSNSESIHEGHE"
     MKIRSKWFPD TRILIGLALI AASFIGVFFV IKTNNSKSQV YVATRPLSIG DKFDAKQFSI        60
     VEANLGANLD KYITPGSLPN AVFNRPIMPG EFLPKSALVP VIDKDIVAVV LRIAGDLPGD       120
     VKEGDLVDVW AAVKIKEEGF WQSELIAKTL RVSRVIVSTS QFDPRGTTKV EVQASRDRLS       180
     YLLNAIANQD KVSIVRASHK EIELLRSAST PRTLDEQDKQ NVGETPDTNP RGPDEKDSNS       240
     ESIHEGHE                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page