(data stored in ACNUC30630 zone)

EMBL: BX251410.PE130

BX251410.PE130       Location/Qualifiers
FT   CDS             153705..154487
FT                   /transl_table=11
FT                   /locus_tag="TW142"
FT                   /product="putative regulator"
FT                   /note="Similar to Bacillus subtilis sporulation initiation
FT                   inhibitor protein SoJ SWALL:SOJ_BACSU (SWALL:P37522) (253
FT                   aa) fasta scores: E(): 0.00051, 30.88% id in 136 aa"
FT                   /protein_id="CAD66822.1"
FT                   /translation="MGKTIAIWGPAGSPGRTTLSINIAATLASYGKKVILIDLDTFGGV
FT                   VSIYLGLDDQKSGLAAICYRADSRSFTPEDLLNIAIKVPIRGGLFYFLSGIAHHSRWPE
FT                   INQPSLLRVIGSAKSAFDYVVMDLSFALDSVGQDTRGRLNYTLMGSGDFLVMVGRGDPI
FT                   GICRFIRAWPEVPKAQNGRSLSIIPVINMVRHTAVGSRPTKQLREVICEYTSFQQVWQI
FT                   DFDQKVCDALLLRGKTIVDCMQNSSVAMQIASIGRVLQ"
     MGKTIAIWGP AGSPGRTTLS INIAATLASY GKKVILIDLD TFGGVVSIYL GLDDQKSGLA        60
     AICYRADSRS FTPEDLLNIA IKVPIRGGLF YFLSGIAHHS RWPEINQPSL LRVIGSAKSA       120
     FDYVVMDLSF ALDSVGQDTR GRLNYTLMGS GDFLVMVGRG DPIGICRFIR AWPEVPKAQN       180
     GRSLSIIPVI NMVRHTAVGS RPTKQLREVI CEYTSFQQVW QIDFDQKVCD ALLLRGKTIV       240
     DCMQNSSVAM QIASIGRVLQ                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page