(data stored in ACNUC30630 zone)

EMBL: BX251410.PE131

BX251410.PE131       Location/Qualifiers
FT   CDS             join(154524..154733,154735..155181)
FT                   /transl_table=11
FT                   /locus_tag="TW143"
FT                   /product="hypothetical phase-variable integral membrane
FT                   protein"
FT                   /note="No significant database matches. Frameshift at
FT                   potentially variable G(11) tract after aa 70"
FT                   /protein_id="CAD66823.1"
FT                   /translation="MSAFHSKVSPHVSSVVPTTNLTYKPNTRNIQVIRGIFKVITLCLI
FT                   KTLIITLCTMTFQTQTYAAQIQTSGGGARSLAEQEHNRTKRGANLFGLFASAVGTAVKT
FT                   KLKELKSTVQRKGKELQNTITRPLQQAVDNTVQTVVAQAAQSATQAVQSQPVQAQVQQL
FT                   TSTATSAVSTLANTVLDDLLGRAKETAKTVGYSLLGVLAAALTGFAIFAIVKWGR"
     MSAFHSKVSP HVSSVVPTTN LTYKPNTRNI QVIRGIFKVI TLCLIKTLII TLCTMTFQTQ        60
     TYAAQIQTSG GGARSLAEQE HNRTKRGANL FGLFASAVGT AVKTKLKELK STVQRKGKEL       120
     QNTITRPLQQ AVDNTVQTVV AQAAQSATQA VQSQPVQAQV QQLTSTATSA VSTLANTVLD       180
     DLLGRAKETA KTVGYSLLGV LAAALTGFAI FAIVKWGR                               218
//

If you have problems or comments...

PBIL Back to PBIL home page