(data stored in ACNUC30630 zone)

EMBL: BX251410.PE133

BX251410.PE133       Location/Qualifiers
FT   CDS             158391..159971
FT                   /transl_table=11
FT                   /locus_tag="TW145"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="Similar to Streptomyces coelicolor putative peptide
FT                   transport system secreted peptide-binding protein SCO5117
FT                   or SC9E12.02 SWALL:Q9F353 (EMBL:AL391751) (544 aa) fasta
FT                   scores: E(): 1.2e-51, 33.57% id in 551 aa"
FT                   /protein_id="CAD66825.1"
FT                   /translation="MRKGFSRVFTFTAVSAVLFVTACFGGKPTDSYVNVNTTKISTGLV
FT                   PANSNELSAHRILSMLFSGLVYIDKDARIQNEVAKSIETADNRVWTITLREDFKFSNGE
FT                   KVTAKSFVDAWNFAAKISNAMGNRDFLGNIEGFTEKGDTDLSGLKILDEYKFRVILKSP
FT                   NRNFVAKLSYSVFWPLPSDAYKDIRAFGLKPIGNGPYSLVSFTQDVEAVLKKNPDYKGP
FT                   RQPRNSGLRYKIYSDPGPAYADVLSDSSDVTDIIPPNAQEKFQSDFPSRWVRREIAATI
FT                   YIAIPGYVAHFAFDREGILRRKAVSMAINRQDIADKIYHGARVPARDFTSPSVLGYKAG
FT                   LPGSDVLKYDPERAKQLWAQADAISPWGSGVLYLNFAATRGDKALFEALANSIKNVLGI
FT                   EVQAYPNTDWKANLLHGQQTKQPFRIGWAADWPAIDTYLGSLFHSQASNNYYEFRNAEY
FT                   DSLLVKAAEALTFPKAQDYYDKLQEILFQNMPVVPLFYDRGGLVWSKNVSNVESNWVGV
FT                   PVYYLITKG"
     MRKGFSRVFT FTAVSAVLFV TACFGGKPTD SYVNVNTTKI STGLVPANSN ELSAHRILSM        60
     LFSGLVYIDK DARIQNEVAK SIETADNRVW TITLREDFKF SNGEKVTAKS FVDAWNFAAK       120
     ISNAMGNRDF LGNIEGFTEK GDTDLSGLKI LDEYKFRVIL KSPNRNFVAK LSYSVFWPLP       180
     SDAYKDIRAF GLKPIGNGPY SLVSFTQDVE AVLKKNPDYK GPRQPRNSGL RYKIYSDPGP       240
     AYADVLSDSS DVTDIIPPNA QEKFQSDFPS RWVRREIAAT IYIAIPGYVA HFAFDREGIL       300
     RRKAVSMAIN RQDIADKIYH GARVPARDFT SPSVLGYKAG LPGSDVLKYD PERAKQLWAQ       360
     ADAISPWGSG VLYLNFAATR GDKALFEALA NSIKNVLGIE VQAYPNTDWK ANLLHGQQTK       420
     QPFRIGWAAD WPAIDTYLGS LFHSQASNNY YEFRNAEYDS LLVKAAEALT FPKAQDYYDK       480
     LQEILFQNMP VVPLFYDRGG LVWSKNVSNV ESNWVGVPVY YLITKG                      526
//

If you have problems or comments...

PBIL Back to PBIL home page