(data stored in ACNUC30630 zone)

EMBL: BX251410.PE134

BX251410.PE134       Location/Qualifiers
FT   CDS             159968..161569
FT                   /transl_table=11
FT                   /locus_tag="TW146"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="Similar to Streptomyces coelicolor putative peptide
FT                   transport system secreted peptide-binding protein SCO5117
FT                   or SC9E12.02 SWALL:Q9F353 (EMBL:AL391751) (544 aa) fasta
FT                   scores: E(): 3.3e-48, 33.39% id in 512 aa"
FT                   /protein_id="CAD66826.1"
FT                   /translation="MKYMNSRFKFFAAFIPVVLFMAACFGGSPGVKGKEMRFGSCEPQT
FT                   ALLPGSVRDECGSGIVTNLFVGLVTRDREGNLINEVAESIETQDNLTYVIKVKKDWKFS
FT                   NGEKVTAKSFVDAWNFTAKKSNAQSNRDDLKYIDGYSADLDGDLSGLKITDEFTFTVKL
FT                   NKKLNDFSERLSNTTAFFPLPSVAYQDIKKFGQNPIGNGPYLLHDRRKNVSWSYRPNRD
FT                   YHGYASQFPIPPSVRVTVYQSGSAKYADYLAGNLDLVDVPQENIETYKQDSEGRHIEGV
FT                   TSVVSYIGITANTPGFELNTEAGKLRRRALSLAIDRQEMGDKLYHGLRFPATGFFSSAF
FT                   FPNYADLPGSDVLKFNLEKAKEFWAEAEKLSPYPRRQIDFFYNVDGGHKIWIDAVVNQL
FT                   KNGLGITNIIPKPVPTFREFLDLVDQDDFSGFFRSGWQTGYIAAPSIETLFTSDGSNNS
FT                   SRYRNPEFDKLAVRAVEAKTSESASLYKELLGILLKDLPLIPLFGYKDALVYGKDVKGI
FT                   KLNKRGIVDTSDMIRE"
     MKYMNSRFKF FAAFIPVVLF MAACFGGSPG VKGKEMRFGS CEPQTALLPG SVRDECGSGI        60
     VTNLFVGLVT RDREGNLINE VAESIETQDN LTYVIKVKKD WKFSNGEKVT AKSFVDAWNF       120
     TAKKSNAQSN RDDLKYIDGY SADLDGDLSG LKITDEFTFT VKLNKKLNDF SERLSNTTAF       180
     FPLPSVAYQD IKKFGQNPIG NGPYLLHDRR KNVSWSYRPN RDYHGYASQF PIPPSVRVTV       240
     YQSGSAKYAD YLAGNLDLVD VPQENIETYK QDSEGRHIEG VTSVVSYIGI TANTPGFELN       300
     TEAGKLRRRA LSLAIDRQEM GDKLYHGLRF PATGFFSSAF FPNYADLPGS DVLKFNLEKA       360
     KEFWAEAEKL SPYPRRQIDF FYNVDGGHKI WIDAVVNQLK NGLGITNIIP KPVPTFREFL       420
     DLVDQDDFSG FFRSGWQTGY IAAPSIETLF TSDGSNNSSR YRNPEFDKLA VRAVEAKTSE       480
     SASLYKELLG ILLKDLPLIP LFGYKDALVY GKDVKGIKLN KRGIVDTSDM IRE              533
//

If you have problems or comments...

PBIL Back to PBIL home page