(data stored in ACNUC30630 zone)

EMBL: BX251410.PE135

BX251410.PE135       Location/Qualifiers
FT   CDS             complement(161570..162175)
FT                   /transl_table=11
FT                   /locus_tag="TW147"
FT                   /product="putative ABC transporter integral membrane
FT                   subunit"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein smc00963 r00889 or smc00963
FT                   SWALL:Q92RI2 (EMBL:AL591785) (201 aa) fasta scores: E():
FT                   2.3e-12, 34.23% id in 184 aa"
FT                   /protein_id="CAD66827.1"
FT                   /translation="MKVGVKVKEYNKDGQKYVGRRIPKTPVAVKLLGLAVYGVLMYNIS
FT                   GVYLLLLFLPSLLFFLRVSVAFIKQLIILVGIVSLVNLVFSGAEYAAYSALRMSALLAG
FT                   AYTVSRTTRFSEFLNFFIIVATPLRIFGLNQKRVGLTLSMTVRFVPEILTLHTQVREAQ
FT                   IARGVQKKPLAIFLPFTVLSLNMAQEIATAIASRGFED"
     MKVGVKVKEY NKDGQKYVGR RIPKTPVAVK LLGLAVYGVL MYNISGVYLL LLFLPSLLFF        60
     LRVSVAFIKQ LIILVGIVSL VNLVFSGAEY AAYSALRMSA LLAGAYTVSR TTRFSEFLNF       120
     FIIVATPLRI FGLNQKRVGL TLSMTVRFVP EILTLHTQVR EAQIARGVQK KPLAIFLPFT       180
     VLSLNMAQEI ATAIASRGFE D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page