(data stored in ACNUC30630 zone)

EMBL: BX251410.PE136

BX251410.PE136       Location/Qualifiers
FT   CDS             complement(162302..162985)
FT                   /transl_table=11
FT                   /locus_tag="TW148"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="Similar to Deinococcus radiodurans ABC transporter,
FT                   ATP-binding protein dr2469 SWALL:Q9RRL9 (EMBL:AE002076)
FT                   (226 aa) fasta scores: E(): 3.2e-27, 42.98% id in 221 aa"
FT                   /protein_id="CAD66828.1"
FT                   /translation="MIAIEFSNVSLEIDDCKILREINLVFSAHRIGIIGVNGSGKSTLV
FT                   RLINGLHFPSNGCVKVDGIEVNKKTVKQIRRMVGFVFQNPQTQLVMPEVREDLKFGLKN
FT                   MGIQNIESAIEEVSVMLGIQNLLGRNTYQLSGGEKQMVALATILVTKPKVLVFDEPTTY
FT                   LDLMSFNRLSEIVNTLPQQIITISHNLDLIQTCNQVILMNQGQVAYDGPPKNAIAKYRE
FT                   LCKSA"
     MIAIEFSNVS LEIDDCKILR EINLVFSAHR IGIIGVNGSG KSTLVRLING LHFPSNGCVK        60
     VDGIEVNKKT VKQIRRMVGF VFQNPQTQLV MPEVREDLKF GLKNMGIQNI ESAIEEVSVM       120
     LGIQNLLGRN TYQLSGGEKQ MVALATILVT KPKVLVFDEP TTYLDLMSFN RLSEIVNTLP       180
     QQIITISHNL DLIQTCNQVI LMNQGQVAYD GPPKNAIAKY RELCKSA                     227
//

If you have problems or comments...

PBIL Back to PBIL home page