(data stored in ACNUC30630 zone)

EMBL: BX251410.PE137

BX251410.PE137       Location/Qualifiers
FT   CDS             163138..164073
FT                   /transl_table=11
FT                   /locus_tag="TW149"
FT                   /product="putative ABC transporter integral membrane
FT                   subunit"
FT                   /note="Similar to Streptomyces coelicolor putative peptide
FT                   transport system integral membrane protein SCO5118 or
FT                   SC9E12.03 SWALL:Q9F352 (EMBL:AL391751) (307 aa) fasta
FT                   scores: E(): 6.3e-45, 42.15% id in 306 aa, and to Bacillus
FT                   subtilis oligopeptide transport system permease protein
FT                   OppB SWALL:OPPB_BACSU (SWALL:P24138) (311 aa) fasta scores:
FT                   E(): 2.4e-28, 34.07% id in 314 aa"
FT                   /protein_id="CAD66829.1"
FT                   /translation="MGRYVLFRLLQFVPVFVGATFLIYLLVFLMPGDPIAALFGDKRPS
FT                   PDVVAAIREQYNLDKPFIVQYFIWFSGILTGNMGVTFSGQSVTEVLGSTIPVSAQLGFM
FT                   ALVIQLLLGLSVGLIAGLRPYRLFDTTSTLFLLALVSIPSFVLAFLLQFFIGIQLRLLP
FT                   VTVGGDTSFYRMLLPAFSLGLLGMVGYARVFRGEILKTRAQDFVNFAYSKGLSKARVIF
FT                   GHIVRNSLLVVVTLIGFDLAGLIGGAIITEGIFNVPGVGNVFYQATIRGEGPTIVSFSA
FT                   VFVIAFMLANLLVDISYSYIDPRIRLSGRK"
     MGRYVLFRLL QFVPVFVGAT FLIYLLVFLM PGDPIAALFG DKRPSPDVVA AIREQYNLDK        60
     PFIVQYFIWF SGILTGNMGV TFSGQSVTEV LGSTIPVSAQ LGFMALVIQL LLGLSVGLIA       120
     GLRPYRLFDT TSTLFLLALV SIPSFVLAFL LQFFIGIQLR LLPVTVGGDT SFYRMLLPAF       180
     SLGLLGMVGY ARVFRGEILK TRAQDFVNFA YSKGLSKARV IFGHIVRNSL LVVVTLIGFD       240
     LAGLIGGAII TEGIFNVPGV GNVFYQATIR GEGPTIVSFS AVFVIAFMLA NLLVDISYSY       300
     IDPRIRLSGR K                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page