(data stored in ACNUC30630 zone)

EMBL: BX251410.PE139

BX251410.PE139       Location/Qualifiers
FT   CDS             165037..166665
FT                   /transl_table=11
FT                   /locus_tag="TW151"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   peptide ABC transporter ATP-binding protein Rv3663c or
FT                   mtv025.011c or mt3764 SWALL:O69631 (EMBL:AL022121) (548 aa)
FT                   fasta scores: E(): 2e-88, 52.67% id in 543 aa"
FT                   /protein_id="CAD66831.1"
FT                   /translation="MNTVEPPLLDVRNLQIEFSTPTRAIKAVDGVSFTLEKGDTLAIVG
FT                   ESGSGKSTLAHSVIGLLPGTGRITEGQINYAGRDLVKLSQKQLEGVRGHNIGFVPQDPM
FT                   QSLNPVLRIGAQVEEAIRANALASDNKEIRKLAIQALENAGLPNPSDRIRSYPHQLSGG
FT                   MQQRVLIGIALSCHPGLLIADEPTSALDVTVQKVILDHIAERTSSLGTAVMLITHDLAL
FT                   AAERARRLLVMYKGKVVELGSSEEILKNPRHPYTKKLLGAAARARRSPLRSKEQDTAPP
FT                   AVVVDSLVKRYPIRSGTFSTSLLTAVDGVSFSIPSGSTVALVGESGSGKSTIAKIILGF
FT                   EKPTRGTVTIAGVNTSSLSASGLRRMAARIQPVFQNPYGSLDPLRNIASIISEPLSIHK
FT                   VGNRASRKARVVELLDQVALPQFIATRYPGELSGGQRQRVAIARALALKPEIMILDEAV
FT                   SALDALVQSQILDLLDSLQKQLSVSYLFITHDLAVARAISDFVCVMHQGKLVEQGPAER
FT                   IFNNPESKYTRTLLESIPGRLFSWG"
     MNTVEPPLLD VRNLQIEFST PTRAIKAVDG VSFTLEKGDT LAIVGESGSG KSTLAHSVIG        60
     LLPGTGRITE GQINYAGRDL VKLSQKQLEG VRGHNIGFVP QDPMQSLNPV LRIGAQVEEA       120
     IRANALASDN KEIRKLAIQA LENAGLPNPS DRIRSYPHQL SGGMQQRVLI GIALSCHPGL       180
     LIADEPTSAL DVTVQKVILD HIAERTSSLG TAVMLITHDL ALAAERARRL LVMYKGKVVE       240
     LGSSEEILKN PRHPYTKKLL GAAARARRSP LRSKEQDTAP PAVVVDSLVK RYPIRSGTFS       300
     TSLLTAVDGV SFSIPSGSTV ALVGESGSGK STIAKIILGF EKPTRGTVTI AGVNTSSLSA       360
     SGLRRMAARI QPVFQNPYGS LDPLRNIASI ISEPLSIHKV GNRASRKARV VELLDQVALP       420
     QFIATRYPGE LSGGQRQRVA IARALALKPE IMILDEAVSA LDALVQSQIL DLLDSLQKQL       480
     SVSYLFITHD LAVARAISDF VCVMHQGKLV EQGPAERIFN NPESKYTRTL LESIPGRLFS       540
     WG                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page