(data stored in ACNUC30630 zone)

EMBL: BX251410.PE14

BX251410.PE14        Location/Qualifiers
FT   CDS             13628..13999
FT                   /transl_table=11
FT                   /locus_tag="TW014"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO1562 or SCL11.18 SWALL:Q9L1C0
FT                   (EMBL:AL157953) (138 aa) fasta scores: E(): 1.2e-12, 41.02%
FT                   id in 117 aa"
FT                   /protein_id="CAD66706.1"
FT                   /translation="MAKVLFASYALLAVASLGRSAYQISTRFYEAPLAYSLSGFAAIVY
FT                   LVVFVSLVYSLRCLAYCALFIELIGVVVIGTLSIFAPGLFGTGNHIAATVWTLYGVGYF
FT                   FLPAALPVLGIIWLSRSKR"
     MAKVLFASYA LLAVASLGRS AYQISTRFYE APLAYSLSGF AAIVYLVVFV SLVYSLRCLA        60
     YCALFIELIG VVVIGTLSIF APGLFGTGNH IAATVWTLYG VGYFFLPAAL PVLGIIWLSR       120
     SKR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page