(data stored in ACNUC30630 zone)

EMBL: BX251410.PE140

BX251410.PE140       Location/Qualifiers
FT   CDS             complement(171897..172667)
FT                   /transl_table=11
FT                   /locus_tag="TW152"
FT                   /product="putative membrane protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66832.1"
FT                   /translation="MNRPIKTIRSRQCLVIFFFTLCLSVMFVILSLIATEWQYALLALI
FT                   LCVCSCLPFYVLFASPKLEVHQEYLRVVGPVRELRLPFDDIEEVLAAPMLTLKLKSGKV
FT                   ISCWGIIKRGRLLESEIQEARLSGEWSEIIPVSQSGQTYSSEIHPNLRAGTIRLDDEKE
FT                   REKGQYGGGHECNKHNAPEKDPLQKNPLQLSISHSEIPRGCTSAISSPEVGTEMGAEID
FT                   TRLISRSYNTLNIALLIVSCSLLFVSYFTLYYFQ"
     MNRPIKTIRS RQCLVIFFFT LCLSVMFVIL SLIATEWQYA LLALILCVCS CLPFYVLFAS        60
     PKLEVHQEYL RVVGPVRELR LPFDDIEEVL AAPMLTLKLK SGKVISCWGI IKRGRLLESE       120
     IQEARLSGEW SEIIPVSQSG QTYSSEIHPN LRAGTIRLDD EKEREKGQYG GGHECNKHNA       180
     PEKDPLQKNP LQLSISHSEI PRGCTSAISS PEVGTEMGAE IDTRLISRSY NTLNIALLIV       240
     SCSLLFVSYF TLYYFQ                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page