(data stored in ACNUC30630 zone)

EMBL: BX251410.PE143

BX251410.PE143       Location/Qualifiers
FT   CDS             179181..180542
FT                   /transl_table=11
FT                   /locus_tag="TW155"
FT                   /product="putative phospho-sugar mutase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   phospho-sugar mutase SCO4736 or sc6g4.14 SWALL:Q53876
FT                   (EMBL:AL031317) (452 aa) fasta scores: E(): 3.6e-76, 50% id
FT                   in 458 aa"
FT                   /db_xref="GOA:Q83NS5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NS5"
FT                   /protein_id="CAD66835.1"
FT                   /translation="MARLFGTDGIRALANGDLLTPELAMAVARAAAVVFTHGRVAKRRQ
FT                   VLGKRPVAIVARDPRISGDFLVAAISAGLASSGVDVLDAGVIPTPAVAFLVKNANADFG
FT                   FMISASHNPGYDNGVKIFAHGGVKLPDVVEDRIEYFLDKQKLSPIGSKVGRITRFVDAE
FT                   DRYQMHLLSTLFTRIDGVKVVIDCANGAASGVSPDVFKSAGAAVKVICADPNGVNINDG
FT                   VGSAYPERLRAEVIRNSATLGLAFDGDADRCIAVDSNGNTVDGDQIMAILARSMQQRGT
FT                   LRNKTLVTTIMSNIGLDRAMKKLGINLKRTQVGDRYVIEAMTQGGFNIGGEQSGHIILS
FT                   DYSTAGDGILAGLHLCAEIIRTGKSLTDLASIMEIVPQVTANIETDDPTTLLNNKKIRH
FT                   EISRIEKSLKGRVVIRPSGTEPLIRIMVEDLNPEKAERACSHLADFFKQEIQKS"
     MARLFGTDGI RALANGDLLT PELAMAVARA AAVVFTHGRV AKRRQVLGKR PVAIVARDPR        60
     ISGDFLVAAI SAGLASSGVD VLDAGVIPTP AVAFLVKNAN ADFGFMISAS HNPGYDNGVK       120
     IFAHGGVKLP DVVEDRIEYF LDKQKLSPIG SKVGRITRFV DAEDRYQMHL LSTLFTRIDG       180
     VKVVIDCANG AASGVSPDVF KSAGAAVKVI CADPNGVNIN DGVGSAYPER LRAEVIRNSA       240
     TLGLAFDGDA DRCIAVDSNG NTVDGDQIMA ILARSMQQRG TLRNKTLVTT IMSNIGLDRA       300
     MKKLGINLKR TQVGDRYVIE AMTQGGFNIG GEQSGHIILS DYSTAGDGIL AGLHLCAEII       360
     RTGKSLTDLA SIMEIVPQVT ANIETDDPTT LLNNKKIRHE ISRIEKSLKG RVVIRPSGTE       420
     PLIRIMVEDL NPEKAERACS HLADFFKQEI QKS                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page