(data stored in ACNUC30630 zone)

EMBL: BX251410.PE145

BX251410.PE145       Location/Qualifiers
FT   CDS             181855..183954
FT                   /transl_table=11
FT                   /locus_tag="TW157"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches. Has possible
FT                   N-terminal secretion signal sequence and 3 possible
FT                   membrane spanning regions in the C-terminal portion.
FT                   Similar to CDS TW161 - TW157 residues 8-275 identical to
FT                   TW161 residues 7-274, though not similar at sequence level
FT                   TW161 C-terminal portion also contains 3 possible membrane
FT                   spanning regions. Region following identity with TW161 is
FT                   an array of small repeats."
FT                   /protein_id="CAD66837.1"
FT                   /translation="MKKQYRHPLSYLTKAFTLLLTLLLLSSLQYETAFARQTPPALSLL
FT                   SSVSSTSVSSNTKYTRVSNTNTQEVCVTTNTNVSLLIDPVTSSTKQTLSCTPSLSPQPQ
FT                   THIYVPYTDTSSYLYVPYITNTHISLYYTDKKADPSSFLTFPHTDIATPYGDEKVVSIT
FT                   KTTTNLIALLTTRNIFFFDIHVTEKPKITVPIHKQIDNTYLSDIPSLRNSRYTFSLTHP
FT                   NKDITIDRYTGQIHLSSLPTSPITAIAINKDTSTHITYAIDTHNPTTHNRSKRAAPRQS
FT                   SGYSWGDLFGNITSAAAGAITSALSGLANSFLGSSTTPSLSSTATGVSIGQSTITITPN
FT                   ARGSPTSYIATPTGATSGGANAAGLPKGLTLNSSGTITGSIDTGVSQGIYTVVVTATAS
FT                   KTSIVSATYTLLVTSTTPSLSGTTITIYTTTPVSLSVTGFITGYAINPTTPTDTSSQKT
FT                   HTVTINIDKTNGNITITPSIVPGTYTVTITATAPSYTSSATTLTSTIVIAVYTLVLSSM
FT                   KFFQRVKYYITKPFKAIYSWFSHTCTPVHHTTSQGFLGAATALLPAAVTSLVDAYNAFY
FT                   SAAHNSDACYDWKSYAYPVASLYGQVGIKALYRKISAHLPSFSGWGGKFFRAFMSAVSV
FT                   GAVYFLPFYLYGKLVKKPASSSGSGSNSNNSSLSGIIRNYFTGNWRTLLPGLFAPALTL
FT                   LTLWF"
     MKKQYRHPLS YLTKAFTLLL TLLLLSSLQY ETAFARQTPP ALSLLSSVSS TSVSSNTKYT        60
     RVSNTNTQEV CVTTNTNVSL LIDPVTSSTK QTLSCTPSLS PQPQTHIYVP YTDTSSYLYV       120
     PYITNTHISL YYTDKKADPS SFLTFPHTDI ATPYGDEKVV SITKTTTNLI ALLTTRNIFF       180
     FDIHVTEKPK ITVPIHKQID NTYLSDIPSL RNSRYTFSLT HPNKDITIDR YTGQIHLSSL       240
     PTSPITAIAI NKDTSTHITY AIDTHNPTTH NRSKRAAPRQ SSGYSWGDLF GNITSAAAGA       300
     ITSALSGLAN SFLGSSTTPS LSSTATGVSI GQSTITITPN ARGSPTSYIA TPTGATSGGA       360
     NAAGLPKGLT LNSSGTITGS IDTGVSQGIY TVVVTATASK TSIVSATYTL LVTSTTPSLS       420
     GTTITIYTTT PVSLSVTGFI TGYAINPTTP TDTSSQKTHT VTINIDKTNG NITITPSIVP       480
     GTYTVTITAT APSYTSSATT LTSTIVIAVY TLVLSSMKFF QRVKYYITKP FKAIYSWFSH       540
     TCTPVHHTTS QGFLGAATAL LPAAVTSLVD AYNAFYSAAH NSDACYDWKS YAYPVASLYG       600
     QVGIKALYRK ISAHLPSFSG WGGKFFRAFM SAVSVGAVYF LPFYLYGKLV KKPASSSGSG       660
     SNSNNSSLSG IIRNYFTGNW RTLLPGLFAP ALTLLTLWF                              699
//

If you have problems or comments...

PBIL Back to PBIL home page