(data stored in ACNUC30630 zone)

EMBL: BX251410.PE148

BX251410.PE148       Location/Qualifiers
FT   CDS             191188..192282
FT                   /transl_table=11
FT                   /locus_tag="TW160"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   uncharacterized membrane proteins cgl2282 SWALL:BAB99675
FT                   (EMBL:AP005281) (264 aa) fasta scores: E(): 2.1e-24, 43.16%
FT                   id in 278 aa"
FT                   /protein_id="CAD66840.1"
FT                   /translation="MKDNHDRERKKWRRYLRREITEARIYEILATRFKQKQIFLDLAKA
FT                   EKRHAQHWRNLLGNEPDPKPKDFLLRLMAKYGSKVIVLSFLQRAEAKAPYFRDVNAVHM
FT                   AADETIHKEVIRAVAAPNRQSISGPFRAAVFGINDGLVSNTALIVTMAVFTDNITLLLL
FT                   TGFGGLLSGSLSMAAGEYVSVTSQKELINSNTPDPESYKALSNLSIDANELSLVYRARG
FT                   MTPAQAQHRANRVLEIVRHTDNLRLHVPDPITSNLNQHHSNTTGLPNDHNQALGNPWTA
FT                   AITSFILFATGALIPLLPFLIPIPIHLALPTSLTLFTLCLLITGAVIALLSGSNIIVKA
FT                   LRQLIIGALATILTSILTLFFGHH"
     MKDNHDRERK KWRRYLRREI TEARIYEILA TRFKQKQIFL DLAKAEKRHA QHWRNLLGNE        60
     PDPKPKDFLL RLMAKYGSKV IVLSFLQRAE AKAPYFRDVN AVHMAADETI HKEVIRAVAA       120
     PNRQSISGPF RAAVFGINDG LVSNTALIVT MAVFTDNITL LLLTGFGGLL SGSLSMAAGE       180
     YVSVTSQKEL INSNTPDPES YKALSNLSID ANELSLVYRA RGMTPAQAQH RANRVLEIVR       240
     HTDNLRLHVP DPITSNLNQH HSNTTGLPND HNQALGNPWT AAITSFILFA TGALIPLLPF       300
     LIPIPIHLAL PTSLTLFTLC LLITGAVIAL LSGSNIIVKA LRQLIIGALA TILTSILTLF       360
     FGHH                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page