(data stored in ACNUC30630 zone)

EMBL: BX251410.PE149

BX251410.PE149       Location/Qualifiers
FT   CDS             193769..196159
FT                   /transl_table=11
FT                   /locus_tag="TW161"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches. Has possible
FT                   N-terminal secretion signal sequence and 3 possible
FT                   membrane spanning regions in the C-terminal portion.
FT                   Similar to CDS TW157 - TW161 residues 7-274 identical to
FT                   TW157 residues 8-275, though not similar at sequence level
FT                   TW157 C-terminal portion also contains 3 possible membrane
FT                   spanning regions."
FT                   /protein_id="CAD66841.1"
FT                   /translation="MPTSPNPLSYLTKAFTLLLTLLLLSSLQYETAFARQTPPALSLLS
FT                   SVSSTSVSSNTKYTRVSNTNTQEVCVTTNTNVSLLIDPVTSSTKQTLSCTPSLSPQPQT
FT                   HIYVPYTDTSSYLYVPYITNTHISLYYTDKKADPSSFLTFPHTDIATPYGDEKVVSITK
FT                   TTTNLIALLTTRNIFFFDIHVTEKPKITVPIHKQIDNTYLSDIPSLRNSRYTFSLTHPN
FT                   KDITIDRYTGQIHLSSLPTSPITAIAINKDTSTHITYAIDTHNPTTHNRSKREMQDRQI
FT                   KNPHVNRSPLKVQDRALINTSLDKWCSELTICNGGNEPIIRYYGYLMLTPNISNITTTV
FT                   SVNQSTITISPSWSIPGKIIRTSTDSHGWLHGTGFAKSYATPTSFLINTSNVITNGMNS
FT                   MFSLPSGLTLNTSNGEITGSIDKSVTPGLYQFVVTAFFGKTLSYVNPFFGKNWTYTFTL
FT                   SDSYTTATYQIYVTYRESNSLYITLIQGQNLSLTAPFPSRYAMTLLHTAGSLPSGLNLV
FT                   SRSITGIVAGPPGVYEYVVTYARTATIGQYSKHGTSSTNVFLKGICNTCSRKTAIFEHM
FT                   PKDVYTTLSTVITPELAVVTYIFTVLGQLKTNTVHTYASLGAKRVSISLPVPPFFLLFS
FT                   QYTYTTLTSPGSGLPKGLTLDRYRKYITGSINPSITQGVYIAYITALAVFTIAVDAVYI
FT                   TVYNTDISTTSIKTSVLIGQSSVYIPLPSSSFYTLSVTETDRTEPGVGLPSGLFIDTAV
FT                   GVVRGQVNRNVRPGLYTVNISLDVFKIRKKDTLFIYVLPYTPL"
     MPTSPNPLSY LTKAFTLLLT LLLLSSLQYE TAFARQTPPA LSLLSSVSST SVSSNTKYTR        60
     VSNTNTQEVC VTTNTNVSLL IDPVTSSTKQ TLSCTPSLSP QPQTHIYVPY TDTSSYLYVP       120
     YITNTHISLY YTDKKADPSS FLTFPHTDIA TPYGDEKVVS ITKTTTNLIA LLTTRNIFFF       180
     DIHVTEKPKI TVPIHKQIDN TYLSDIPSLR NSRYTFSLTH PNKDITIDRY TGQIHLSSLP       240
     TSPITAIAIN KDTSTHITYA IDTHNPTTHN RSKREMQDRQ IKNPHVNRSP LKVQDRALIN       300
     TSLDKWCSEL TICNGGNEPI IRYYGYLMLT PNISNITTTV SVNQSTITIS PSWSIPGKII       360
     RTSTDSHGWL HGTGFAKSYA TPTSFLINTS NVITNGMNSM FSLPSGLTLN TSNGEITGSI       420
     DKSVTPGLYQ FVVTAFFGKT LSYVNPFFGK NWTYTFTLSD SYTTATYQIY VTYRESNSLY       480
     ITLIQGQNLS LTAPFPSRYA MTLLHTAGSL PSGLNLVSRS ITGIVAGPPG VYEYVVTYAR       540
     TATIGQYSKH GTSSTNVFLK GICNTCSRKT AIFEHMPKDV YTTLSTVITP ELAVVTYIFT       600
     VLGQLKTNTV HTYASLGAKR VSISLPVPPF FLLFSQYTYT TLTSPGSGLP KGLTLDRYRK       660
     YITGSINPSI TQGVYIAYIT ALAVFTIAVD AVYITVYNTD ISTTSIKTSV LIGQSSVYIP       720
     LPSSSFYTLS VTETDRTEPG VGLPSGLFID TAVGVVRGQV NRNVRPGLYT VNISLDVFKI       780
     RKKDTLFIYV LPYTPL                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page