(data stored in ACNUC30630 zone)

EMBL: BX251410.PE15

BX251410.PE15        Location/Qualifiers
FT   CDS             14121..15404
FT                   /transl_table=11
FT                   /locus_tag="TW015"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66707.1"
FT                   /translation="MRVGCLGKEVGLVRAQAIFRLVVLSILCVSVLLPTRWVLATPALK
FT                   PQSFSVAIGESLNRPPIPAAARGSVYTVNTKDLTAPGDGLPRGLDINRGTGTISGSVGS
FT                   DVLPGVYKPRVSVTSSAGSTSAVYTITVTRQIVLGDVLAQIKQGDPVRIPAKIIGGHSL
FT                   FNFRLAGKPRTTPGIAYPMGLSVDSKTGVLFGTVSYEVEYGVYNFLLWADEVIHGEIVS
FT                   HFAYYTLLVSPMHFNVDDQNFELQAYKPFQFPLSANGAAIAWVATGLPKGIYLSPAGLL
FT                   YGVPAVPPGEYSARLTVYGLEVRSGVLKIVSVTANLNILVAGEPIIYPQSITVKKGESV
FT                   SFPAKPPHKPGWVYWANMVDITTPGNGIPDGLILSPDNGTLYGAVSPSVQPGVYTPTVF
FT                   KAVPGEVEYAHSTTYTITVVEGTAPGAN"
     MRVGCLGKEV GLVRAQAIFR LVVLSILCVS VLLPTRWVLA TPALKPQSFS VAIGESLNRP        60
     PIPAAARGSV YTVNTKDLTA PGDGLPRGLD INRGTGTISG SVGSDVLPGV YKPRVSVTSS       120
     AGSTSAVYTI TVTRQIVLGD VLAQIKQGDP VRIPAKIIGG HSLFNFRLAG KPRTTPGIAY       180
     PMGLSVDSKT GVLFGTVSYE VEYGVYNFLL WADEVIHGEI VSHFAYYTLL VSPMHFNVDD       240
     QNFELQAYKP FQFPLSANGA AIAWVATGLP KGIYLSPAGL LYGVPAVPPG EYSARLTVYG       300
     LEVRSGVLKI VSVTANLNIL VAGEPIIYPQ SITVKKGESV SFPAKPPHKP GWVYWANMVD       360
     ITTPGNGIPD GLILSPDNGT LYGAVSPSVQ PGVYTPTVFK AVPGEVEYAH STTYTITVVE       420
     GTAPGAN                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page