(data stored in ACNUC30630 zone)

EMBL: BX251410.PE150

BX251410.PE150       Location/Qualifiers
FT   CDS             complement(197697..199415)
FT                   /transl_table=11
FT                   /locus_tag="TW162"
FT                   /product="putative ABC transporter (ATP-binding and
FT                   integral membrane)"
FT                   /note="Similar to Escherichia coli transport ATP-binding
FT                   protein CydC or MdrA or MdrH or SurB or b0886
FT                   SWALL:CYDC_ECOLI (SWALL:P23886) (573 aa) fasta scores: E():
FT                   4.8e-32, 27.92% id in 573 aa"
FT                   /protein_id="CAD66842.1"
FT                   /translation="MLKDLLILAGKLRKCLGLFTLATLVLIIWNLAETGIAVVSLFISS
FT                   AFFSDTQAELQGLFILLFSLVVVYPVFNLLDIWLAHDVANRILHILRVSTYSAINRIAP
FT                   LGLQNKRTADIASAALSDTSELEWFYTQILPSAIFTIVNSIIFTTILTWLIGPIGLFMI
FT                   IPMILTIIFPFVLVPIQRRQGVASRETLVDLRAAVLNAVQGQRELRSLGMVKKQHEVVI
FT                   AATERVQKIKNAHNLRKALELAFSSLVTAAGSIILLIILTDRVLNGQLDGRILPVAILL
FT                   AGLSVIPSYILADAMGRMGDFGACAMRINKILKAKDPIPTEPRRGLEKHHNEDNTLVAD
FT                   DIGFSYDSQPVLSGVNLTVSPSRSVAIVGHSGAGKSTLANLAMRFLDPDDGEMRFDGLN
FT                   LHGYNPDVYRQRLSLVPQDCHIFAGTIRQNLELAKDGVSDDAIWEALKLADIATLVESL
FT                   GGLDAPVGDRGTTLSGGERQRIGIARAFLRNPDMLILDEPLANIDPLLEANIAANVRRL
FT                   RGGRTTIVIAHRLASIRIADHIIVLDNGGVVAQGTHKKLLNNMHYLELLGNQIQQ"
     MLKDLLILAG KLRKCLGLFT LATLVLIIWN LAETGIAVVS LFISSAFFSD TQAELQGLFI        60
     LLFSLVVVYP VFNLLDIWLA HDVANRILHI LRVSTYSAIN RIAPLGLQNK RTADIASAAL       120
     SDTSELEWFY TQILPSAIFT IVNSIIFTTI LTWLIGPIGL FMIIPMILTI IFPFVLVPIQ       180
     RRQGVASRET LVDLRAAVLN AVQGQRELRS LGMVKKQHEV VIAATERVQK IKNAHNLRKA       240
     LELAFSSLVT AAGSIILLII LTDRVLNGQL DGRILPVAIL LAGLSVIPSY ILADAMGRMG       300
     DFGACAMRIN KILKAKDPIP TEPRRGLEKH HNEDNTLVAD DIGFSYDSQP VLSGVNLTVS       360
     PSRSVAIVGH SGAGKSTLAN LAMRFLDPDD GEMRFDGLNL HGYNPDVYRQ RLSLVPQDCH       420
     IFAGTIRQNL ELAKDGVSDD AIWEALKLAD IATLVESLGG LDAPVGDRGT TLSGGERQRI       480
     GIARAFLRNP DMLILDEPLA NIDPLLEANI AANVRRLRGG RTTIVIAHRL ASIRIADHII       540
     VLDNGGVVAQ GTHKKLLNNM HYLELLGNQI QQ                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page