(data stored in ACNUC30630 zone)

EMBL: BX251410.PE151

BX251410.PE151       Location/Qualifiers
FT   CDS             complement(199447..201318)
FT                   /transl_table=11
FT                   /locus_tag="TW163"
FT                   /product="putative ABC transporter (ATP-binding and
FT                   integral membrane)"
FT                   /note="Similar to Clostridium perfringens probable ABC
FT                   transporter cpe0226 SWALL:Q8XNV6 (EMBL:AP003185) (576 aa)
FT                   fasta scores: E(): 2.7e-35, 26.56% id in 576 aa"
FT                   /protein_id="CAD66843.1"
FT                   /translation="MEPISFLTRLLVRLRVCYGKRPPNSRLDLLGSNYRSCDSLVLSEK
FT                   LRVMRAGKITIRLLLPPVLMNLLSFGAYIIAGVFNALLFTELLSQRRLFEITILIGGIA
FT                   LTLIARPLISVGEAVLETRAGTRVKQNLRQALLTELDRRGPMRVGFWRSGKIQALISDG
FT                   IESIDLYFVKYFVHFITTVVSGIVIVIIIWQINWIIAVVLLFCAIGMVGIPRLWDKALG
FT                   KKGQEHWVAYENMNADFIDAMMGMSTLKSFGAAERYGKKLEEQSNRLLSSTRRRLRISL
FT                   GENGLRSLMRALGPALGLVIAIFQIRAGHMEIGQLFLVIMLSIELFRPLNTLVILYYGA
FT                   FFGIAAVSSINEILEERSHSVAHNNHETPSLTGLTGFDRVSYTYIGADKSALTHTTFSI
FT                   PSNKTTAIVGLSGSGKSTALGLLMGFDRPNSGQIRVFGNDPVSIDTTKVMTLVPQDPVI
FT                   FPGTIREILASANRKATEAEMIEALRYAQETTLHLETEHDELDILDVCIFEHGKNLSGG
FT                   QKQRLAIARALIRNTPILVLDESTSALDTMTESALLKAIRTARPDLTLLIVTHRIDTAA
FT                   KADQVVVMANGSVTCAGAPQLLARDKDSVWSKLVKAQLGDVNVERIE"
     MEPISFLTRL LVRLRVCYGK RPPNSRLDLL GSNYRSCDSL VLSEKLRVMR AGKITIRLLL        60
     PPVLMNLLSF GAYIIAGVFN ALLFTELLSQ RRLFEITILI GGIALTLIAR PLISVGEAVL       120
     ETRAGTRVKQ NLRQALLTEL DRRGPMRVGF WRSGKIQALI SDGIESIDLY FVKYFVHFIT       180
     TVVSGIVIVI IIWQINWIIA VVLLFCAIGM VGIPRLWDKA LGKKGQEHWV AYENMNADFI       240
     DAMMGMSTLK SFGAAERYGK KLEEQSNRLL SSTRRRLRIS LGENGLRSLM RALGPALGLV       300
     IAIFQIRAGH MEIGQLFLVI MLSIELFRPL NTLVILYYGA FFGIAAVSSI NEILEERSHS       360
     VAHNNHETPS LTGLTGFDRV SYTYIGADKS ALTHTTFSIP SNKTTAIVGL SGSGKSTALG       420
     LLMGFDRPNS GQIRVFGNDP VSIDTTKVMT LVPQDPVIFP GTIREILASA NRKATEAEMI       480
     EALRYAQETT LHLETEHDEL DILDVCIFEH GKNLSGGQKQ RLAIARALIR NTPILVLDES       540
     TSALDTMTES ALLKAIRTAR PDLTLLIVTH RIDTAAKADQ VVVMANGSVT CAGAPQLLAR       600
     DKDSVWSKLV KAQLGDVNVE RIE                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page