(data stored in ACNUC30630 zone)

EMBL: BX251410.PE152

BX251410.PE152       Location/Qualifiers
FT   CDS             complement(202542..203240)
FT                   /transl_table=11
FT                   /locus_tag="TW164"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO2196 or SC5F7.05 or SC3H12.04
FT                   SWALL:Q9S2P0 (EMBL:AL096872) (234 aa) fasta scores: E():
FT                   5.7e-15, 31.89% id in 232 aa"
FT                   /protein_id="CAD66844.1"
FT                   /translation="MPKSNKKAPGRIAQIMQVLRIACSGRPKVVVYLIAAGITPLVAGI
FT                   SAAVILAYTSILVFILLILISVGAALLSFMITLGKQAEKVAYSQVEGRPGATGAVIKTF
FT                   RGCWQTSEIPVAVNPKTADAIYRAVGKCGVVLIIEGMRQRAQKMLAEEQRRVKRVLPNI
FT                   QIHVLNVNHLDPKSVPLNRLGKKMRSLKKTLHRSEVWKAGKLLDAIPKNYMPVPKGMDL
FT                   KKPVKRPSRG"
     MPKSNKKAPG RIAQIMQVLR IACSGRPKVV VYLIAAGITP LVAGISAAVI LAYTSILVFI        60
     LLILISVGAA LLSFMITLGK QAEKVAYSQV EGRPGATGAV IKTFRGCWQT SEIPVAVNPK       120
     TADAIYRAVG KCGVVLIIEG MRQRAQKMLA EEQRRVKRVL PNIQIHVLNV NHLDPKSVPL       180
     NRLGKKMRSL KKTLHRSEVW KAGKLLDAIP KNYMPVPKGM DLKKPVKRPS RG               232
//

If you have problems or comments...

PBIL Back to PBIL home page