(data stored in ACNUC30630 zone)

EMBL: BX251410.PE153

BX251410.PE153       Location/Qualifiers
FT   CDS             203335..204531
FT                   /transl_table=11
FT                   /locus_tag="TW165"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   serine/threonine protein kinase SCO1724 or SCI11.13
FT                   SWALL:Q9S2A6 (EMBL:AL096849) (550 aa) fasta scores: E():
FT                   0.0015, 30.3% id in 165 aa, and to Amycolatopsis
FT                   mediterranei serine/threonine kinase PkmA SWALL:Q9KK90
FT                   (EMBL:AF135382) (589 aa) fasta scores: E(): 0.0043, 25.59%
FT                   id in 168 aa"
FT                   /protein_id="CAD66845.1"
FT                   /translation="MIPFFNKHTRSTDDKDTEKARQIIGNYRVIKTLHESDRAVIYLAQ
FT                   EISGDPGMVARQSFMDPGELVNLVALKMYRAGVTSEHIAIEADALDSLRGPGVVELRDV
FT                   LNLPDKRGLVMRALHGPALVDLWETRGSLSPGEMVTILASLVATLARISSAGYAHGAVW
FT                   PGNIRFDDIGRPVLTGFSSARKHAPPNADWLDFYSLLRGCAVLINEKQEQMLQISAGVR
FT                   KRLDPFDPELPAWVEASLFRLADPQPLRFEHPISLHDTSGYNLRESPNPVDSNRQTGKS
FT                   QIILKLTDNKYVAAILGKLKRPSVLFIALFVSVFVVLLMVIPNNSGEDNERKSEKPGYV
FT                   KSKGTFKKPSKTGKSRKRSEVSEKLRKNMEECLASKDADCVDVMSEINADLGEKLDEG"
     MIPFFNKHTR STDDKDTEKA RQIIGNYRVI KTLHESDRAV IYLAQEISGD PGMVARQSFM        60
     DPGELVNLVA LKMYRAGVTS EHIAIEADAL DSLRGPGVVE LRDVLNLPDK RGLVMRALHG       120
     PALVDLWETR GSLSPGEMVT ILASLVATLA RISSAGYAHG AVWPGNIRFD DIGRPVLTGF       180
     SSARKHAPPN ADWLDFYSLL RGCAVLINEK QEQMLQISAG VRKRLDPFDP ELPAWVEASL       240
     FRLADPQPLR FEHPISLHDT SGYNLRESPN PVDSNRQTGK SQIILKLTDN KYVAAILGKL       300
     KRPSVLFIAL FVSVFVVLLM VIPNNSGEDN ERKSEKPGYV KSKGTFKKPS KTGKSRKRSE       360
     VSEKLRKNME ECLASKDADC VDVMSEINAD LGEKLDEG                               398
//

If you have problems or comments...

PBIL Back to PBIL home page