(data stored in ACNUC30630 zone)

EMBL: BX251410.PE154

BX251410.PE154       Location/Qualifiers
FT   CDS             205328..207172
FT                   /transl_table=11
FT                   /locus_tag="TW166"
FT                   /product="putative transcription factor"
FT                   /note="Similar to Caulobacter crescentus elongation factor
FT                   TU family protein cc0741 SWALL:Q9AA65 (EMBL:AE005749) (610
FT                   aa) fasta scores: E(): 4e-83, 43.18% id in 616 aa, and to
FT                   Streptomyces coelicolor putative GTP-binding protein
FT                   SCO5111 or SCBAC31E11.07 SWALL:Q93IU4 (EMBL:AL596043) (635
FT                   aa) fasta scores: E(): 8.9e-80, 56.85% id in 635 aa"
FT                   /protein_id="CAD66846.1"
FT                   /translation="MITKDIRNIAVVAHVDHGKTTLISAMLQQTSDSTTAEDRVLDSHE
FT                   LEREKGITILAKNTAVTYKSSGRSVTLNIVDTPGHADFGGEVERGMSMVDGVVVLVDAS
FT                   EGPLPQTRFVLKKALLKKLPIVLAVNKTDRSDARIDDVVSEFQDLLISLAEEINDPAIY
FT                   SILDVPIVYVSGRAGRASINKPDNGQLPDRNNLDDLFEKIISYIPAPEYDKSAPLQAHV
FT                   ANIDASAFLGRLALTRIYNGSISKGQTVCWVNTSSKQRVNVRVTELLKTVALDRVPVPS
FT                   VSAGDIVAIAGIPDVMIGDSICDPDDVRPLPGISIDEPAISVVIGVNTSPLAGGVPGHK
FT                   LTATQIKERLDRETIGNVSIRVIPTRGTDAWEVQGRGELALAVLIEQMRREGFELTVGK
FT                   PSAVTRIVDGSLHEPYELLTVNLMDEYFGSVTKLLAERKCRVESVISNAGWTNADFVVP
FT                   SRGLIGFRTEFLTITRGTGTANAIFHSYAPWSGQINQRAQGSAVADRAGHVTSYAILGL
FT                   QERVLFFVSPSERVYEGMVVGRNSRPGDLNVNVTKGKKLTNTRSSTAEELEKIVPARHL
FT                   SLEECLEFAGPDECVEVTPEAIRIRKIELSQSVRSKQR"
     MITKDIRNIA VVAHVDHGKT TLISAMLQQT SDSTTAEDRV LDSHELEREK GITILAKNTA        60
     VTYKSSGRSV TLNIVDTPGH ADFGGEVERG MSMVDGVVVL VDASEGPLPQ TRFVLKKALL       120
     KKLPIVLAVN KTDRSDARID DVVSEFQDLL ISLAEEINDP AIYSILDVPI VYVSGRAGRA       180
     SINKPDNGQL PDRNNLDDLF EKIISYIPAP EYDKSAPLQA HVANIDASAF LGRLALTRIY       240
     NGSISKGQTV CWVNTSSKQR VNVRVTELLK TVALDRVPVP SVSAGDIVAI AGIPDVMIGD       300
     SICDPDDVRP LPGISIDEPA ISVVIGVNTS PLAGGVPGHK LTATQIKERL DRETIGNVSI       360
     RVIPTRGTDA WEVQGRGELA LAVLIEQMRR EGFELTVGKP SAVTRIVDGS LHEPYELLTV       420
     NLMDEYFGSV TKLLAERKCR VESVISNAGW TNADFVVPSR GLIGFRTEFL TITRGTGTAN       480
     AIFHSYAPWS GQINQRAQGS AVADRAGHVT SYAILGLQER VLFFVSPSER VYEGMVVGRN       540
     SRPGDLNVNV TKGKKLTNTR SSTAEELEKI VPARHLSLEE CLEFAGPDEC VEVTPEAIRI       600
     RKIELSQSVR SKQR                                                         614
//

If you have problems or comments...

PBIL Back to PBIL home page