(data stored in ACNUC30630 zone)

EMBL: BX251410.PE155

BX251410.PE155       Location/Qualifiers
FT   CDS             207488..208330
FT                   /transl_table=11
FT                   /locus_tag="TW167"
FT                   /product="conserved hypothetical protein"
FT                   /note="Has C-terminal similarity to proteins of undefined
FT                   function. Similar to Streptococcus pyogenes hypothetical
FT                   protein Spym18_1743 SWALL:AAL98271 (EMBL:AE010084) (153 aa)
FT                   fasta scores: E(): 1.6e-10, 40% id in 140 aa"
FT                   /protein_id="CAD66847.1"
FT                   /translation="MRTGVDLVDIIDFKKKIDRSNRLLERLFAPTELSNSYNRKALSVR
FT                   FALKESVIKALGGLAGTWHDIQTSGGTHLPISVSLSGSMLLKADELGLNEWAASVTHSS
FT                   GFAIANVVAQHNTTISHPPWSIQVPTCGATECLGYVLGSVLKPGDVVLLVGELGAGKTT
FT                   FTKGIAAGLGIESAVVSPTFTLVREHVAQNGGMNHVDCYRLIHDFDDFDLDLDNRVTVV
FT                   EWPLSFFWNLPRYLSFKIDFTSKDNTRIFTLHAKGFDIKELAFITHTMSQSHTMSQSQ"
     MRTGVDLVDI IDFKKKIDRS NRLLERLFAP TELSNSYNRK ALSVRFALKE SVIKALGGLA        60
     GTWHDIQTSG GTHLPISVSL SGSMLLKADE LGLNEWAASV THSSGFAIAN VVAQHNTTIS       120
     HPPWSIQVPT CGATECLGYV LGSVLKPGDV VLLVGELGAG KTTFTKGIAA GLGIESAVVS       180
     PTFTLVREHV AQNGGMNHVD CYRLIHDFDD FDLDLDNRVT VVEWPLSFFW NLPRYLSFKI       240
     DFTSKDNTRI FTLHAKGFDI KELAFITHTM SQSHTMSQSQ                             280
//

If you have problems or comments...

PBIL Back to PBIL home page