(data stored in ACNUC30630 zone)

EMBL: BX251410.PE156

BX251410.PE156       Location/Qualifiers
FT   CDS             208351..209856
FT                   /transl_table=11
FT                   /locus_tag="TW169"
FT                   /product="conserved hypothetical protein"
FT                   /note="Localised similarity to proteins of unknown
FT                   function. C-terminal similar to Thermoanaerobacter
FT                   tengcongensis acetyltransferases RimI3 or tte0537
FT                   SWALL:Q8RC99 (EMBL:AE013024) (149 aa) fasta scores: E():
FT                   5e-10, 37.24% id in 145 aa. N-termional similar to
FT                   Corynebacterium glutamicum inactive homologs of
FT                   metal-dependent proteases, putative molecular chaperones
FT                   cgl0592 SWALL:BAB97985 (EMBL:AP005275) (225 aa) fasta
FT                   scores: E(): 0.00017, 39.62% id in 106 aa"
FT                   /protein_id="CAD66848.1"
FT                   /translation="MKILAIDTSSRLAIACLEIDNNRITTVGKCIEDSGRLHSELIAEA
FT                   ISQACSELQSLSFIAVCLGPGFYTGLRSGLVAARILGLSLSIPVYGVMAHDAIYMGYLS
FT                   CEEHVFCDRGLHTSQVFSHHEPVSKSADGANHEEFCDRNTYSMGDAIHRNVPSIARTII
FT                   TPAGRRQFYWSRYTGLDNDGLPIIYAGPGLIDSCDINILSQDFPFNPVFVASAHEPQFE
FT                   AQKESNGTLTGSPRPRRTGRHIDRGSCPPNVSSTIPPGIFRARVPQAHDCAINVVSKNS
FT                   MRETDTLKTDASIDKSITSDRPNTQPILPVSAVNPVILGKLAYLQLKAKRACSRIEPFY
FT                   MRRADVTLRVPSGEINKDLVSIHPASLHDLPDIMKIERGSFTGEEWSSATMLQQLRLGS
FT                   YFVLKVSDMPVGYAGISHPRFEDVDLETLAIDPAWRRKGLGGILLRHLFEYARDAGVKR
FT                   CFLEVKVCNLPAIGMYKKHGFVTLGRRPKYYNGVDAITMKKEL"
     MKILAIDTSS RLAIACLEID NNRITTVGKC IEDSGRLHSE LIAEAISQAC SELQSLSFIA        60
     VCLGPGFYTG LRSGLVAARI LGLSLSIPVY GVMAHDAIYM GYLSCEEHVF CDRGLHTSQV       120
     FSHHEPVSKS ADGANHEEFC DRNTYSMGDA IHRNVPSIAR TIITPAGRRQ FYWSRYTGLD       180
     NDGLPIIYAG PGLIDSCDIN ILSQDFPFNP VFVASAHEPQ FEAQKESNGT LTGSPRPRRT       240
     GRHIDRGSCP PNVSSTIPPG IFRARVPQAH DCAINVVSKN SMRETDTLKT DASIDKSITS       300
     DRPNTQPILP VSAVNPVILG KLAYLQLKAK RACSRIEPFY MRRADVTLRV PSGEINKDLV       360
     SIHPASLHDL PDIMKIERGS FTGEEWSSAT MLQQLRLGSY FVLKVSDMPV GYAGISHPRF       420
     EDVDLETLAI DPAWRRKGLG GILLRHLFEY ARDAGVKRCF LEVKVCNLPA IGMYKKHGFV       480
     TLGRRPKYYN GVDAITMKKE L                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page