(data stored in ACNUC30630 zone)

EMBL: BX251410.PE158

BX251410.PE158       Location/Qualifiers
FT   CDS             212254..213477
FT                   /transl_table=11
FT                   /locus_tag="TW171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO3406 or SCE9.13c SWALL:Q9X8I6 (EMBL:AL049841)
FT                   (352 aa) fasta scores: E(): 2.6e-11, 32.66% id in 401 aa"
FT                   /db_xref="GOA:Q83I94"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I94"
FT                   /protein_id="CAD66850.1"
FT                   /translation="MLHRPRITPAVANARRAMLNTLPADLHNQLVLIALSGGRDSLAAM
FT                   VIASWVIPRLNGRVGAVVVDHGLQENSARIADEVRIRAEQFALNPILIKRVSPSRVSAG
FT                   PEASARIARYAAFYDTLEETKAYAIILAHTLDDQAETVLLGLMRGSGPSSLRGMKAVSY
FT                   TPEDCRYMNNKACNSVTAVYAHNTQRCSCDSRPYPPPPEPRNENRSYFPHPSCKCVEGS
FT                   ATRFTNADIDSRFGVFIRPFLDITRHETGKICEFYGLDYWNDPHNEDVRFSRVRIRHNV
FT                   MPVLENEIGPGVKYALSRTAKLAQLDTEYLDHLSNELLDEIASKESDWSIRLPINTLQK
FT                   TPVPIRLRVIRLAALQYFTVSLSFKHTRQIERLLCSSCDIKHVNLPRLITAQRVGNYIY
FT                   MHTLRGKL"
     MLHRPRITPA VANARRAMLN TLPADLHNQL VLIALSGGRD SLAAMVIASW VIPRLNGRVG        60
     AVVVDHGLQE NSARIADEVR IRAEQFALNP ILIKRVSPSR VSAGPEASAR IARYAAFYDT       120
     LEETKAYAII LAHTLDDQAE TVLLGLMRGS GPSSLRGMKA VSYTPEDCRY MNNKACNSVT       180
     AVYAHNTQRC SCDSRPYPPP PEPRNENRSY FPHPSCKCVE GSATRFTNAD IDSRFGVFIR       240
     PFLDITRHET GKICEFYGLD YWNDPHNEDV RFSRVRIRHN VMPVLENEIG PGVKYALSRT       300
     AKLAQLDTEY LDHLSNELLD EIASKESDWS IRLPINTLQK TPVPIRLRVI RLAALQYFTV       360
     SLSFKHTRQI ERLLCSSCDI KHVNLPRLIT AQRVGNYIYM HTLRGKL                     407
//

If you have problems or comments...

PBIL Back to PBIL home page