(data stored in ACNUC30630 zone)

EMBL: BX251410.PE165

BX251410.PE165       Location/Qualifiers
FT   CDS             220402..221079
FT                   /transl_table=11
FT                   /locus_tag="TW178"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66857.1"
FT                   /translation="MTALSNWLLVSQGGVSHESVSKAIVSMPVSTITIFIPAVGIMFIS
FT                   RDFVSGYILRATLLLGDWRRFFFLRAIEAVVLSALFVLAICVLSVLFSSVFLAFAGYPV
FT                   GKAFSSDLFLSLLSCIPVSCVVGLMAYFLGWALRGAVVFMSVYFPYVFVADPVLSLLIP
FT                   NFVWFSYPGAVTRATNFFPTTPGEHALSGYTSPYIGFSVVLAYCAVAFLLAYFRNTRRG
FT                   GIL"
     MTALSNWLLV SQGGVSHESV SKAIVSMPVS TITIFIPAVG IMFISRDFVS GYILRATLLL        60
     GDWRRFFFLR AIEAVVLSAL FVLAICVLSV LFSSVFLAFA GYPVGKAFSS DLFLSLLSCI       120
     PVSCVVGLMA YFLGWALRGA VVFMSVYFPY VFVADPVLSL LIPNFVWFSY PGAVTRATNF       180
     FPTTPGEHAL SGYTSPYIGF SVVLAYCAVA FLLAYFRNTR RGGIL                       225
//

If you have problems or comments...

PBIL Back to PBIL home page