(data stored in ACNUC30630 zone)

EMBL: BX251410.PE168

BX251410.PE168       Location/Qualifiers
FT   CDS             223106..223651
FT                   /transl_table=11
FT                   /locus_tag="TW181"
FT                   /product="putative secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66860.1"
FT                   /translation="MVMSVVKMRILAALLTIPLMFLIAIGPVSAETQHVQETAIRLTAD
FT                   DTNQIIKELEQAGFTKQVTGNKRQETITLTKDGVTVTLTHVTQQTQTRLSWGDDPWGFY
FT                   IKLEWHEQVALAAGTLAAGGGAGLALKAALKIAVKAGTAFLAGLEVVDKLSDIIGAGPC
FT                   PPFQPRYIRFDPFRTKCN"
     MVMSVVKMRI LAALLTIPLM FLIAIGPVSA ETQHVQETAI RLTADDTNQI IKELEQAGFT        60
     KQVTGNKRQE TITLTKDGVT VTLTHVTQQT QTRLSWGDDP WGFYIKLEWH EQVALAAGTL       120
     AAGGGAGLAL KAALKIAVKA GTAFLAGLEV VDKLSDIIGA GPCPPFQPRY IRFDPFRTKC       180
     N                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page