(data stored in ACNUC30630 zone)

EMBL: BX251410.PE169

BX251410.PE169       Location/Qualifiers
FT   CDS             223721..224497
FT                   /transl_table=11
FT                   /locus_tag="TW182"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66861.1"
FT                   /translation="MNRQSSFFPLLTGFFTYLFLLTRPHKRRLFMAGLVRKYYRDSTAR
FT                   TLIFDFYEYSVEGGILCLLLGVPSYIQLTEPLLLALVVALVALCVALIMHHSQYTLVLF
FT                   DDWGIDKRSFLLRYSYYSQTPSFQNPTKRRQILLLDTVTRYGSKWSRVYVATMAVCIFF
FT                   LVGTPISAWYLGALSFFACLFYTCFFTILPSIIFPFAFDGFPALLVRKLLYNLHIRRHG
FT                   PIPKELTDMVTQAYEIYPERLYPWFRSRKNQKCESR"
     MNRQSSFFPL LTGFFTYLFL LTRPHKRRLF MAGLVRKYYR DSTARTLIFD FYEYSVEGGI        60
     LCLLLGVPSY IQLTEPLLLA LVVALVALCV ALIMHHSQYT LVLFDDWGID KRSFLLRYSY       120
     YSQTPSFQNP TKRRQILLLD TVTRYGSKWS RVYVATMAVC IFFLVGTPIS AWYLGALSFF       180
     ACLFYTCFFT ILPSIIFPFA FDGFPALLVR KLLYNLHIRR HGPIPKELTD MVTQAYEIYP       240
     ERLYPWFRSR KNQKCESR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page