(data stored in ACNUC30630 zone)

EMBL: BX251410.PE17

BX251410.PE17        Location/Qualifiers
FT   CDS             complement(16396..18048)
FT                   /transl_table=11
FT                   /locus_tag="TW017"
FT                   /product="putative phosphomannomutase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   phosphomannomutase SCO4916 or SCK13.08c SWALL:Q9AD82
FT                   (EMBL:AL512667) (549 aa) fasta scores: E(): 9.1e-77, 44.21%
FT                   id in 536 aa, and to Streptococcus thermophilus
FT                   phosphoglucomutase PgmA SWALL:Q9K560 (EMBL:AJ243290) (572
FT                   aa) fasta scores: E(): 1.1e-28, 33.27% id in 544 aa"
FT                   /protein_id="CAD66709.1"
FT                   /translation="MNILRKASLWIENDPVAITRLEMRRLLAESEKTGDVRELEERLSK
FT                   TLEFGTAGLRAPQGAGFNRVNAVVTAQAANALSQFLLEENRGRTLVIGYDGRYNSQLWA
FT                   RNTARIASSYDITALIMPRALPTPLLAFAVRQLGAAAGVMVTASHNPREYNGYKVYLGG
FT                   EDKGAQIPDTAAAKIAKNLRDEVAYSDIPMKDSYGILDEEIIEAYLSRTAKAIKRQFGS
FT                   PKADLKICHTAMHGVGHEIFVRLMEKLGFHNLVFVEEQKMPDPAFPTLPFPNPEEKGAL
FT                   DLAFETARLAECDIIIANDPDADRVAVAHPDGKVFTGNEIGALLGVEIARMQRGHGVLS
FT                   NSMVSSPIMRRIAETYGMQHVETPTGFKWVARVPDICFGFEEALGYMIHPELVRDKDGL
FT                   SAGAAIATIAASQKAQGRSLRDCLDDLQSKLGYFRSTQYAVRMASLDSVQAVMQNLRAE
FT                   SLNKIGRFRVTKYRDLLFGSPPVDLLEFNLGQDIDDLFGRLIVRPSGTELKLKCYIDSV
FT                   AKTPDGAEQLLSELTYACKNLLCETSRRGGAEN"
     MNILRKASLW IENDPVAITR LEMRRLLAES EKTGDVRELE ERLSKTLEFG TAGLRAPQGA        60
     GFNRVNAVVT AQAANALSQF LLEENRGRTL VIGYDGRYNS QLWARNTARI ASSYDITALI       120
     MPRALPTPLL AFAVRQLGAA AGVMVTASHN PREYNGYKVY LGGEDKGAQI PDTAAAKIAK       180
     NLRDEVAYSD IPMKDSYGIL DEEIIEAYLS RTAKAIKRQF GSPKADLKIC HTAMHGVGHE       240
     IFVRLMEKLG FHNLVFVEEQ KMPDPAFPTL PFPNPEEKGA LDLAFETARL AECDIIIAND       300
     PDADRVAVAH PDGKVFTGNE IGALLGVEIA RMQRGHGVLS NSMVSSPIMR RIAETYGMQH       360
     VETPTGFKWV ARVPDICFGF EEALGYMIHP ELVRDKDGLS AGAAIATIAA SQKAQGRSLR       420
     DCLDDLQSKL GYFRSTQYAV RMASLDSVQA VMQNLRAESL NKIGRFRVTK YRDLLFGSPP       480
     VDLLEFNLGQ DIDDLFGRLI VRPSGTELKL KCYIDSVAKT PDGAEQLLSE LTYACKNLLC       540
     ETSRRGGAEN                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page