(data stored in ACNUC30630 zone)

EMBL: BX251410.PE170

BX251410.PE170       Location/Qualifiers
FT   CDS             224723..225307
FT                   /transl_table=11
FT                   /locus_tag="TW184"
FT                   /product="putative peptidase"
FT                   /note="Similar to Aeromonas hydrophila type 4 prepilin-like
FT                   proteins leader peptide processing enzyme [includes: leader
FT                   peptidase tapD] SWALL:LEP4_AERHY (SWALL:P45794) (290 aa)
FT                   fasta scores: E(): 1.5e-05, 29.44% id in 197 aa, and to
FT                   Escherichia coli leader peptidase HopD SWALL:HOPD_ECOLI
FT                   (SWALL:O68932) (155 aa) fasta scores: E(): 0.0017, 32.7% id
FT                   in 159 aa"
FT                   /protein_id="CAD66862.1"
FT                   /translation="MTKPVAYSIYALIVILTGIGLGIIGLPFATLAFIAIFVSTPALFR
FT                   ADIRELRLPNAITLPLIAIGIVALLADQIVHPNLDIVFSALIAIGLSSFLFIVSIFGGM
FT                   GMGDVKLSLALLLCAANLGPAFPIIAISSAFLVAFCFCILIFVGLFRFFKNSGRISCLP
FT                   FGPFLLLGFWTTVIVWGIDRWTDVDILRIIW"
     MTKPVAYSIY ALIVILTGIG LGIIGLPFAT LAFIAIFVST PALFRADIRE LRLPNAITLP        60
     LIAIGIVALL ADQIVHPNLD IVFSALIAIG LSSFLFIVSI FGGMGMGDVK LSLALLLCAA       120
     NLGPAFPIIA ISSAFLVAFC FCILIFVGLF RFFKNSGRIS CLPFGPFLLL GFWTTVIVWG       180
     IDRWTDVDIL RIIW                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page