(data stored in ACNUC30630 zone)

EMBL: BX251410.PE171

BX251410.PE171       Location/Qualifiers
FT   CDS             225473..226039
FT                   /transl_table=11
FT                   /locus_tag="TW186"
FT                   /product="putative integral membrane protein"
FT                   /protein_id="CAD66863.1"
FT                   /translation="MYITWITPQVRPITPYIVTCALILSPARYRYRITVTPSQQAHTLS
FT                   LQSVAHGQRLIYLDLEMWSVRFFRLVCLRLGVLLLLVLVSSLFSLFGTAGVTFFLGGVP
FT                   VGLLLGISTLTLFYLSIRLMFLSRIYLAISGVTNFAVVVFYGRNIPADQVVIWIWMASL
FT                   PIICGTILSVPLFGSRRYGASAPDA"
     MYITWITPQV RPITPYIVTC ALILSPARYR YRITVTPSQQ AHTLSLQSVA HGQRLIYLDL        60
     EMWSVRFFRL VCLRLGVLLL LVLVSSLFSL FGTAGVTFFL GGVPVGLLLG ISTLTLFYLS       120
     IRLMFLSRIY LAISGVTNFA VVVFYGRNIP ADQVVIWIWM ASLPIICGTI LSVPLFGSRR       180
     YGASAPDA                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page