(data stored in ACNUC30630 zone)

EMBL: BX251410.PE172

BX251410.PE172       Location/Qualifiers
FT   CDS             226082..226408
FT                   /transl_table=11
FT                   /locus_tag="TW187"
FT                   /product="ferredoxin"
FT                   /note="Similar to Streptomyces griseus ferredoxin
FT                   SWALL:FER_STRGR (SWALL:P13279) (105 aa) fasta scores: E():
FT                   1.8e-33, 79.2% id in 101 aa"
FT                   /protein_id="CAD66864.1"
FT                   /translation="MTYVIAFPCVDLKDRACIDECPVDCIYEGGRSLYINPDECVDCGA
FT                   CEPVCPVEAIYYEDDLPEEWGEYYRANVEFFDEIGSPGGAAKLGPVDFDHPIIAQLPKS
FT                   SDSV"
     MTYVIAFPCV DLKDRACIDE CPVDCIYEGG RSLYINPDEC VDCGACEPVC PVEAIYYEDD        60
     LPEEWGEYYR ANVEFFDEIG SPGGAAKLGP VDFDHPIIAQ LPKSSDSV                    108
//

If you have problems or comments...

PBIL Back to PBIL home page