(data stored in ACNUC30630 zone)

EMBL: BX251410.PE173

BX251410.PE173       Location/Qualifiers
FT   CDS             226431..227699
FT                   /transl_table=11
FT                   /locus_tag="TW188"
FT                   /product="putative integral membrane protein"
FT                   /note="Weakly similar to Streptomyces coelicolor putative
FT                   integral membrane protein SCO1752 or 2SCI34.05 SWALL:Q9EWX4
FT                   (EMBL:AL445403) (396 aa) fasta scores: E(): 4.1e-05, 24.72%
FT                   id in 364 aa"
FT                   /protein_id="CAD66865.1"
FT                   /translation="MSSRFSLFTPRCLLRFACIIAQFTKRVFLRFWNGHWVVTILGIYI
FT                   ASRIVTTILVLIVSTNQQPTFAISHNPDYFAFANIWDARWYESIVYFGYPKVLPTNAFG
FT                   YVGQNAWAFLPGYPIAVKLVMFLFGLGFQKAAVAISLIFGFLTCIVMYLLQRSLFSRDR
FT                   AMLCVLLFAFNPLSPLFQFGYADTYSLFFVLLALWFLRLREYALLVAVLPGIAFSRPIA
FT                   LAFALGLILLFLMRCVKSRQGKEEFPKKDFMSLLIASVVAVILGFAWPVIAGIFSGRLD
FT                   AYLATELSWRIYMQSDPHFAIFQPWFLAFYFYATYFGMPGWIGILTAAVIILILLFVLF
FT                   CYIRRLGDEIFSWSAAYIVYILAVFFPQSSVFRIALPLSPALVLLARRKSIVIIFLVLS
FT                   VILQFVWLDVLWVISPGGDPAPP"
     MSSRFSLFTP RCLLRFACII AQFTKRVFLR FWNGHWVVTI LGIYIASRIV TTILVLIVST        60
     NQQPTFAISH NPDYFAFANI WDARWYESIV YFGYPKVLPT NAFGYVGQNA WAFLPGYPIA       120
     VKLVMFLFGL GFQKAAVAIS LIFGFLTCIV MYLLQRSLFS RDRAMLCVLL FAFNPLSPLF       180
     QFGYADTYSL FFVLLALWFL RLREYALLVA VLPGIAFSRP IALAFALGLI LLFLMRCVKS       240
     RQGKEEFPKK DFMSLLIASV VAVILGFAWP VIAGIFSGRL DAYLATELSW RIYMQSDPHF       300
     AIFQPWFLAF YFYATYFGMP GWIGILTAAV IILILLFVLF CYIRRLGDEI FSWSAAYIVY       360
     ILAVFFPQSS VFRIALPLSP ALVLLARRKS IVIIFLVLSV ILQFVWLDVL WVISPGGDPA       420
     PP                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page